SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013312127.1.29456 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013312127.1.29456
Domain Number 1 Region: 128-215,268-334
Classification Level Classification E-value
Superfamily SMI1/KNR4-like 5.76e-18
Family SMI1/KNR4-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013312127.1.29456
Sequence length 546
Comment hypothetical protein PV05_10253 [Exophiala xenobiotica]; AA=GCF_000835505.1; RF=representative genome; TAX=348802; STAX=348802; NAME=Exophiala xenobiotica; strain=CBS 118157; AL=Scaffold; RT=Major
Sequence
MANSFASAWRSFWHTMTSNDRHASHDSPYRTGQHVPVSQSRHAPLTSVATSAADSHQDLP
ATYHDDSKRPSISSSQLAGSPARPYSPGMRSISSPKAPQVEESVAPGEIQMQNFADGAPP
PPPVSHSWKKIDRWAENHYEELWDQLGEGCTQNDVNELEHELDMTLPQDVRESLSIHDGQ
ERGGRPTGIIFGCMLLDCEEIVQEWKNWKVVNEEYLSGAKSKYSSKGLSNGSSSSSQTQN
GNRFWRQELLDRQESQPPKAIQKAYAHPSWIPLARDWGGNNIAVDLAPGPMGKWGQIILF
GRDYDCKYVVARSWAHFLATVADDIGSEKVFVDEDTGELKLKEFKTEAVEPPYMDILRWR
ADQRYGRRGPKRRPQPASLNTSSVAQNGRQSPYSSPVIGGEDRGRSPQRFSRGPQGSPRH
AVGSPLARVQEEIAQPQPVRPGGDVVRDFAESADSLSEGKKREKLVEGPTPLDLKISNLP
RKPEKLVDAPTPSSLKSADSDKFPATRLARVFTEPEIKEEKPDQEKAEVTGLGVNGIEDE
MKTVSI
Download sequence
Identical sequences A0A0D2E7Z8
XP_013312127.1.29456

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]