SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013357600.1.45086 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013357600.1.45086
Domain Number 1 Region: 751-807
Classification Level Classification E-value
Superfamily RING/U-box 7.57e-17
Family RING finger domain, C3HC4 0.0061
Further Details:      
 
Domain Number 2 Region: 540-616
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000000000000137
Family Cdc48 domain 2-like 0.00027
Further Details:      
 
Weak hits

Sequence:  XP_013357600.1.45086
Domain Number - Region: 503-537
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.0291
Family Cdc48 domain 2-like 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013357600.1.45086
Sequence length 840
Comment hypothetical protein, conserved [Eimeria mitis]; AA=GCF_000499745.1; RF=representative genome; TAX=44415; STAX=44415; NAME=Eimeria mitis; strain=Houghton; AL=Scaffold; RT=Major
Sequence
MLGSAAQPAPPATTETRELQGASSIHRPRDTGGVTVVPMPSAGRHSCSEPGSSVRQLESR
AVGDDNAAAERAAVEKIHLLPVSREAPKAWVFAALTGLMKEGKTVRQYLYLKVRRPTKES
KGSKPKTTTQEKQQKQQQHRVQQQQEQEQQQQEHQQQQEQLQQQQQRRERSSSSEAPDDE
YTYIVVACLPHSGVITSSTVVFTSGSPLQPLRRVQLLALIHPNSAYARRAGVASYSEALQ
RGVVGEFRASSNNNSSNDGRSSQRNQGSHRLAGDVAGISEGSNSNSSSGRSGTEDPAAAP
AAVAEAERRRRQLGSPFDWGASEGTSERRRRRHGPPREYNRAEEVIAAVLDDSDLGSGSG
EDDSGGENEMGGGVPFRLSDAAGPEEGAAASSRDEQQRRHEEERQGQEQEQPLFRQQRTL
QLNFNFPSPSGDQRVAGRGSDCAKAGAQGKGVFNLSENVLFHDFVAPYFRARSGGTSLPS
SPATAADGDNCRDAAVVVFPGKKLVIKDLTFVVWATDPGNGPGFVWKDTAIYISVDPWGE
YRRVHILPFADTLPTTYSFRLFEDYLQPFLKEQPWRLIRKGDIFTFRGVEFKVIATEPST
VPVARVGPETVVHFEGSLNPSLIDILPPEILSRVRRLPARVQPFAIVAAAQSLDPQLLLR
VLPSGGMRGGSRGIDEGLEAAVKRQLVGPFCFSEYQRLYGHLCTRVPQEDAKKGTEKDAR
ESAAVVSPGKLEHSQSSTSSPSAEAAAVGGELEAPCCTVCTLQLQDGTESVTLTCGHAFH
WECARAWLRCSATCPNCRAQVVLPTGTPRESGDAGDSAQAHVGNAALGFVRNAWAEFFSP
Download sequence
Identical sequences U6KHU5
XP_013357600.1.45086

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]