SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013370962.1.28644 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013370962.1.28644
Domain Number 1 Region: 48-539
Classification Level Classification E-value
Superfamily Sema domain 2.75e-94
Family Sema domain 0.0012
Further Details:      
 
Domain Number 2 Region: 1403-1527,1693-1845
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.86e-32
Family p120GAP domain-like 0.022
Further Details:      
 
Domain Number 3 Region: 971-1061
Classification Level Classification E-value
Superfamily E set domains 0.00000000000000222
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.048
Further Details:      
 
Domain Number 4 Region: 880-962
Classification Level Classification E-value
Superfamily E set domains 0.000000000000408
Family Other IPT/TIG domains 0.019
Further Details:      
 
Domain Number 5 Region: 1058-1146
Classification Level Classification E-value
Superfamily E set domains 0.00000000000338
Family Other IPT/TIG domains 0.095
Further Details:      
 
Domain Number 6 Region: 542-594
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000654
Family Plexin repeat 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013370962.1.28644
Sequence length 1917
Comment PREDICTED: plexin-D1 [Chinchilla lanigera]; AA=GCF_000276665.1; RF=representative genome; TAX=34839; STAX=34839; NAME=Chinchilla lanigera; AL=Scaffold; RT=Major
Sequence
MARRARAPAARAPPPLPPPPSPRAGLARPGALLLLLLLAAAARGLEVQRRFASPTPTNNF
ALDGAAGTVYLAAVNRLYQLSGADLSLQAEAAVGPVRDSPLCHAPQLPQASCEHPRRLTD
NHNKILQLDARQGLVVACGSVFQGFCQLRRRGNISALAVRFPPAAPPAAPVAVFPSMLNV
AANHADASTVALVLPPAAGAGGSRLLVGATYTGFGSAFFPRNRSLEDHRFENTPEVAIRS
LDARGDPARLFTFDLNPSDDNVLKIKQGAKERHRLRFVRAFLHPPGSEPYAYLAFTSEAR
SGDKDGQARSLLARICLPRGDAKKLTESYIELGLQCAGGAGRSDLYSRLVSVFPTRERLF
GVFERPPAAPAPRAAPAPAALCAFRFADVQAAIRAARAACFVEPAPGVVAVLDSVVQGTG
PACERKRNLQLQPEQLDCGAAHLQHPLTILQPLKATPVFRAPGLTAVAVASPNNYTAIFL
GTATGRLLKLSLNESMQVVSRRVVTVAYGEPVHPVMQFDPTDPGYLYLMTSHQMARLKVA
ACEAHATCGDCVGAADAYCGWCALETRCTVQQDCANSSQLYFWTSASEGPDRCPAMAVLP
AEINVRQEHPGMILQVSGSLPSLSGLEMACDYGNGIHTVARVPGPADGHQIAYCNLLPRD
RFPAFPPHQDHVTMEMSLRVQGRAIVSANFTIYDCSRIAHVAPSTACTSCLSTRWPCFWC
TEQHACVSNRSQCQASSNPMSPRDCPQTLPSLLAPAPTGSAQDILVPLANAASFRGAALR
CSLGLEDSFEAVWVNDSAVRCSHVLLHTAQKSQVFSLTLQLQGQPPQFLDSPDPVRVVVY
NCAMGSPDCSQCLGREDLGHLCMWSDGCRPRGPLAPPPGSCPAPEIRTIEPLSGPLDGGT
LLTIRGRDLGRRLSDVVHGVWIGDVACKLLAGRYTVSEEIVCVTGPAPAAFSDVVTVNVS
KEGASRERFSYVLPQVHSLEPAMGPTAGGTRITIHGSDLHVGSELQVLVNDTDPCTELVR
SDTSIACTVPAGALPTPVPVCVRFERRGCARGNLSFTYMQNPVITAISPRRSPISGGRTI
TVAGERFHMVQNVSMAVHRIGREPTLCKVLNATLITCPSPGALYNASAPVAFFINGRVYT
DEMAHEALPDPEEVPRGSRFHLDYLPDPQFSTARRERWIRHHPGEPLTLVIHKEQDGLGL
ESHEYRVKIGQVACDIQIVSDRVIHCSVNDSLDAAEGQLPITVQVGNFNQTIATLQLGGS
ETAIVASIVICSVLLLLSVVALFVFCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAE
LQTDMTDLTKELNRSQGIPFLEYKHFVTRTFFPKCSSLYEERYVLPSQSLGSQGGPPVQE
THPLLGEWNVPENCRPSMEEGVSLFSSLLSNKHFLIVFVHALEQQKDFAVRDRCSLASLL
TIALHGKLEYYTSIMKELLVDLIDASAAKNPKLMLRRTESVVEKMLTNWMSICMYSCLRE
TVGEPFFLLLCAIKQQINKGSIDAITGKARYTLNEEWLLRENIEAKPRNLNVSFQGCGMD
SLSVRAMDTDTLTQVKEKILEAFCKNVPYSQWPRAEDVDLEWFATSTQSYILRDLDDTSV
VEDGRKKLNTLAHYKIPEGASLAMSLTDKKDNTLGRVKDLDTEKYFHLVLPTDELAEPKK
SHRQSHRKKVLPEIYLTRLLSTKGTLQKFLDDLFKAILSIREDKPPLAVKYFFDFLEEQA
EKRGILDPDTLHIWKTNSLPLRFWVNILKNPQFVFDIEKTDHIDACLSVIAQAFIDACSI
SDLQLGKDSPTNKLLYAKEIPEYRKVVQRYYKQIQDMAPLSEQEMNAHLAEESRKYQNEF
NTNVALAEIYKYAKRYRPQIVAALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA
Download sequence
Identical sequences XP_013370962.1.28644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]