SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for XP_013389665.1.76062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013389665.1.76062
Domain Number 1 Region: 1023-1082
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.000000000000423
Family Classic zinc finger, C2H2 0.0075
Further Details:      
 
Domain Number 2 Region: 966-1023
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000000000283
Family Classic zinc finger, C2H2 0.022
Further Details:      
 
Domain Number 3 Region: 1067-1121
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000000131
Family Classic zinc finger, C2H2 0.017
Further Details:      
 
Domain Number 4 Region: 249-298
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000127
Family Classic zinc finger, C2H2 0.019
Further Details:      
 
Domain Number 5 Region: 932-968
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000274
Family Classic zinc finger, C2H2 0.037
Further Details:      
 
Domain Number 6 Region: 347-400
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.00000529
Family Classic zinc finger, C2H2 0.024
Further Details:      
 
Domain Number 7 Region: 1136-1186
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000599
Family Classic zinc finger, C2H2 0.06
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013389665.1.76062
Sequence length 1387
Comment PREDICTED: uncharacterized protein LOC106158287 [Lingula anatina]; AA=GCF_001039355.1; RF=representative genome; TAX=7574; STAX=7574; NAME=Lingula anatina; AL=Scaffold; RT=Major
Sequence
MSSSEEDDIHQCGRCRKLFMKLEDYLQHKKSKICKKLSSTSQPLLTEQKDSDCQNAVDKR
DELPEESNHKEVATAVKPQGRKTRQNKAPESPKDEENNVVLGRRGRKRKVKYTDLSEDGD
LEPPPKSPKAQKRKRGRPRKTHSKNNDNRVKQPQHIKNVCETCGYKAMYQWEYDHHMARA
HGVGTANCAQCQAVFPNVADLTEHLHSCPGSKDANNQTDRDSPSGAGTTVTAEKTTGLQD
TPAGTVPEFQCTVCSSSYNEYRLLRDHLKEKHPEVNPCLCMFCGKWYRLKSHLWRHITVE
AHSNLSSKEIEIARIEFEKCTRVRGPNKKNLRKQNEQSATIQRRSSYVCSFCNESFPRKV
LLIRHSKLEHTEKPALLGFSHTCTWCGHNFWKRSILLDHCIKVHKIDIEADLTDICPVCN
KGLKSKYHVIRHRDNLHTPIGATEIRERNMFEVKNADSETSKDETVENKQVEEKKEMKKT
DEKDKTMPTVETVDTEDMANSDISKKDEDLEGKCKSVEESNRDFPNFRCFVCHELFTTNN
SYRHHLECHRIWIPRDELNELLAKQGLMVLAEGESAMHIATPVGNEDQPEEPVSEAASLH
TRHHQDFGPSAPVALQILTPSGEDTAGQVYYTTNTTLAPAFTTALASAQGYVAAPDYTPV
VSSAQQVSVQQVDSHGNYSTIDSSAIHQWAQEQAVLTILQEMGQNSNSKGQQRDQVQTLQ
AVQGNPAVSLHINSASQAVQVTVQPVAIVNAANDFKSTVLSESPSKSNDEMNHGTCNPGQ
ALQPVPASPSSDTGIKCERTLSEIGLEKTSDQFVKQSGDEEEDEEQEEEGKEDIIEDTRY
DYMCPACLKVFHKLETINAHKKNVHSLVAVFRCAKENCRQIFLETDDFIDHHKVHPQQAF
ICRICNEHVESLNNLIGHKVVAHKDIYPSYGFRCKLCHKAFKSQDQLDVHMATASHEHQC
PQCGKVFKAQSELKDHELKHAGIRSFLCDICGVSFVNHAALRKHKSNHNPSRTFVCSECG
NKFHKREHLNRHYRTKHSDERPFKCPEPGCPKAFKRGDKLREHLRNHSNETPYVCQHCAK
AYKHKEALKYHEKTHMTVPVLKHHCEVCNASFIRAAHLANHMQQDHKMAKKRIASHECPT
CKIKFHRQERLNRHMEREHRSDVMWKVTCRLCGKGFAGDKSLQTHIEKRHSAGVLTKTRR
KKNQLPEDQQQIQSQQQEQQPSLQITASVLPTPMVHPAPRYDHTQIPVEAHLLTAMQYMN
RVEPQAPPTSQTHMHLHIPQQSVMSPHPQQLQQPPPQQHIHHDRVMSPHERVMTPQERVL
TPHEPHTGVATQMLMAHHRGTPHSQPQDQPTEAPQEVTHVMNPHPPPPPPPGYMYYPMQG
FVPHTYN
Download sequence
Identical sequences A0A1S3HUE4
XP_013389665.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]