SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013404863.1.76062 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013404863.1.76062
Domain Number 1 Region: 83-248
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.95e-39
Family Ankyrin repeat 0.00058
Further Details:      
 
Domain Number 2 Region: 10-49
Classification Level Classification E-value
Superfamily Ankyrin repeat 0.00000000728
Family Ankyrin repeat 0.0042
Further Details:      
 
Domain Number 3 Region: 302-345
Classification Level Classification E-value
Superfamily SOCS box-like 0.00000667
Family SOCS box-like 0.0057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013404863.1.76062
Sequence length 377
Comment PREDICTED: ankyrin repeat and SOCS box protein 8-like [Lingula anatina]; AA=GCF_001039355.1; RF=representative genome; TAX=7574; STAX=7574; NAME=Lingula anatina; AL=Scaffold; RT=Major
Sequence
MDESSFPSSQSLPLHVACIYRRPDVIKTLLECGAKVDAPDWAGRTPLEIVLFYWPRIPCT
DGIDPKSSYGKYQSYLRDQHARSLRCMRQLIEKGANIQAKVSRSILNRRGQSFLHCTALN
TLPLAAEWLLRYGADIEARDDEGRTPLITAAMLPCLKVAELLMSLGADTNAQDVRGNAPL
HYLVYRGRDYLVRLALELGANSNAANDEHLTPLHVAAEIGNSNAIRLLLLYGANPNSLDN
RGRSALFCVLDDTANAGNSSRLGISLLLRETLYTKVTDKTGNLCKLLNHERFVHLRDTLI
LYTSEPPTLLKMCKVAIRKSIGLRKISGTNVDKLPLPTALKRYIFSPWCFYCRRCECYRQ
NHPKTIPSTIHLKIPSP
Download sequence
Identical sequences A0A1S3J3M6
XP_013404863.1.76062

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]