SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013436024.1.101860 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013436024.1.101860
Domain Number 1 Region: 697-750
Classification Level Classification E-value
Superfamily RING/U-box 8.48e-16
Family RING finger domain, C3HC4 0.0066
Further Details:      
 
Domain Number 2 Region: 481-557
Classification Level Classification E-value
Superfamily Cdc48 domain 2-like 0.000000000000131
Family Cdc48 domain 2-like 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013436024.1.101860
Sequence length 782
Comment hypothetical protein, conserved [Eimeria necatrix]; AA=GCF_000499385.1; RF=representative genome; TAX=51315; STAX=51315; NAME=Eimeria necatrix; strain=Houghton; AL=Scaffold; RT=Major
Sequence
MTGAADSSPQSVNTGAKNSRTPSVCNISTSGSIVCNEAEEGEAAGSGDAEYCAANSQGDS
ICSEGAQNPTVNSTATERTAVEKIHLLPISEEAPKSWVFATLTGLMKECKTVQQYMYIRV
KRPTKENKSPQKGRSRDESDKALSLEATDAEYNYIVVACLPHSGVITSSTVVFTTGAPLK
PLRRIQLLALVHPNSSYARKAGVASYSEALQRGLVGEGSAASQSRRSRRADSTSSSAASP
LQRPENNSNSIENGVTTGEAGYGAADAEMHHRQLGSPFDWEGTHAAGQRHRRRPAPVREF
SRAEDVIAAVLEDSDAGSGGENGGDEDSMGGTPFRLSDATGPEASGARSDSNEAEPPMQH
QRTLQLNFNFSSSSSTDFGASRSGTDGSPGDAPRSLSERVLFYDFVAPYFRARGAGASLP
SSPANAGTDGTSRDTAIVVFPGKKLVIRDLTFVVWATDPDNGPGFVRKDTAMYISVDPWG
EYRRVHILPFADTLPTTYSFRLFEDYLQPFLKEQPWRLIRKGDIFTFRGVEFKVIATEPS
TIPVARVGPETVVHFEGSLNPSLIDILPPDILSRVRRLPARVQPFAIVAAAQSLDPQLLL
RVLPSGNMRGNPRGIDEGLEAAVERQLVGPFCLSAYQRLYAHLCTRKKRHPSREKREEAE
ASGEADTPRCSQEIPSSRSSTAEAEAAVAEAAAGGWELEAPCCTVCTLQLQDGAESVTLT
CGHAFHWDCARAWLRCSATCPNCRAEVVLPSEDHGECRGSNTNVGTAALGFVRSAWADFF
NS
Download sequence
Identical sequences U6MTP1
XP_013436024.1.101860

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]