SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013452647.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_013452647.1.50012
Domain Number - Region: 379-389,458-487
Classification Level Classification E-value
Superfamily Pseudo ankyrin repeat-like 0.0131
Family Pseudo ankyrin repeat 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013452647.1.50012
Sequence length 611
Comment PPR containing plant-like protein [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MSIVPLRKFVWSFTRLGDLKSAYRTLQQMVSLVMRGNISIAKTVYGKLYSTRLDIPVPSN
GRLGSTILDIRKSKQHDSCILSPMYLPNIVSASKEQQIICMDDKKAKSGEINGLNGKKHS
LPMKVLRWSFNDIIHGCANEKNYMLAWKLILQMQSLGLQPSSHTYNGLIRAIVSQRRFGD
AMRMLKKMQQENLKLVDSTLATLSVAFSRELQLDLAESLLNQISECLYPHPYNALLASCD
ALNQPERAVRVFAKMRKIKLLPDMRTYELLFSLFGIVNAPYEDSNMLSQVDAAKRINAIE
RDMANNGFQHSYLSLKNLMKSLGEEGMIRELIQYLHVAENLFLFSNPSLGTDMFNIVLHY
LVEAQEGHMAIEIFKKMKLCGCHPDSTTYNIMIDCCSIIRSYRSASLLISMMIREGFCPV
ACTYTALVKILLEDENFNEAVDVLERIKLDGIKLDVLLFNTFLRQACYRGRIDVIEFIVE
FMHQEKVQPDPATCGYVFSAYVNSSFHNTAIEALQVLSLRMMSEDGNILKERKDLVDEFI
LNEDLASESHIFKLFEDSEDEVATGLLNLRWCAIIGFPLCESADRSLWAKRLELRFQKRL
ASGSRKGVHDF
Download sequence
Identical sequences A0A072ULF5
XP_013452647.1.50012 Medtr6g069480.5

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]