SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013457130.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013457130.1.50012
Domain Number 1 Region: 514-819
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 6.61e-83
Family Protein kinases, catalytic subunit 0.00011
Further Details:      
 
Domain Number 2 Region: 89-201
Classification Level Classification E-value
Superfamily alpha-D-mannose-specific plant lectins 1.31e-22
Family alpha-D-mannose-specific plant lectins 0.0066
Further Details:      
 
Weak hits

Sequence:  XP_013457130.1.50012
Domain Number - Region: 387-440
Classification Level Classification E-value
Superfamily Hairpin loop containing domain-like 0.00392
Family Anti-platelet protein 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013457130.1.50012
Sequence length 847
Comment G-type lectin S-receptor-like Serine/Threonine-kinase [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MDSAKYLFYLVKDHNHKHKLLVLLSSLILLLLTSFCSCSSDTISTVKPLRDGELLISKSK
MFSLGFFAKGKSTSRYVGIWYYNLSIQTVVWVANRDTPINDTSGILSINPNGNLVLNNNL
STIPIWSTDVSLQQSQINSTDVIAQLSDIGNFVLMLNRTKTVIWDSFDYPTDTWLPYQRL
GFDRKTNQSWFLQSWKTEDDPGKGAFTLKFSTVGKTQLFMYKHNLPWWRGEPWNGALLSG
VPNAKRNRDTFNISFVQDDNNVALTYNMVDKSVVTRMVVQQSGFFQILMWDNKKSQWNQF
YSQPTNQCDNYGTCGSNSNCDPMNFADFKCACLPGFEPKSPGDWYESGDGSGGCVRKNGS
SVCGNGEGFIKIVSLKVPDTSMANAKGGLSLEECEKECFRNCSCTAYAVDNVSNGGSGCL
AWHGDLMDIQKVSDQGQDLFLRVDKVELANYYRKSNGVPHKKRLAAILVASIVAVIVLVL
SCVYCKWKKKTKDKMVRQLNQDSFGEKNGVQSNTHPNLPFFSFKTIMTATRNCGHENKLG
QGGFGSVYKGCLANGQEIAVKRLSKNSGQGKEEFKTEVTLLVKLQHRNLVRLLGCCFEKE
ERMLVYEYLPNKSLDFFIFDQNQRSLLDWGKRFEIICGIARGVLYLHQDSRLKIIHRDLK
ASNVLLDAAMNPKISDFGMARIFGEDEIQARTKRVVGTYGYMSPEYAMEGRYSTKSDVFS
FGVLLLEIIAGQRNTHCETGRDSPNLIGHVWTLWTEGRALDTVDPALNQSYPSAIVLRCI
QIGLLCVQENAINRPSMLDVVFMLCNETPLLPPLKPAFLFNGNHELQEPSTSGSSINELT
ETTISAR
Download sequence
Identical sequences A0A072UP57
Medtr4g091850.1 XP_013457130.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]