SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013457625.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013457625.1.50012
Domain Number 1 Region: 96-274
Classification Level Classification E-value
Superfamily ADP-ribosylation 0.000000000000691
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013457625.1.50012
Sequence length 275
Comment zinc finger (C2H2 type) family protein, putative [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MASGWVKSLQCKSRAFEDVYHPYPKTLLTSASCRKTVQNIKDIVEIPKPKKPKTSLEKHS
SSKSKYPTNNKSETPTMNRSRSMTATTTTSSSSRAITELPEGHPSRNVVDIIFHTSWGNN
EFPGRVEMIFKVQNGARTMSRFEEFREAVKTRAASSVSDSEENARCVADGNEVMQFHCLG
PAEDGGPHGSWSFPERKGAAICTFSGSGGAHENSGGGKGRMAMLVCRVVAGRVSKRVGYL
DYKRVGFDSVSGDNGELLVFDSRAVLPCFLIIYRL
Download sequence
Identical sequences A0A072UQM2
XP_013457625.1.50012 Medtr4g101450.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]