SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013463121.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013463121.1.50012
Domain Number 1 Region: 1-181,320-392
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 4.49e-60
Family Bacterial dinuclear zinc exopeptidases 0.00033
Further Details:      
 
Domain Number 2 Region: 171-303
Classification Level Classification E-value
Superfamily Bacterial exopeptidase dimerisation domain 9.24e-24
Family Bacterial exopeptidase dimerisation domain 0.00065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013463121.1.50012
Sequence length 392
Comment allantoate amidohydrolase [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MEDAGLRTWVDQMGNVHGRVEGANANAEALLVGSHMDTVVDAGKFDGALGIVSAISALKV
MHVNGKLQNLTRPVEVIAFCDEEGVRFQTTFLGSGALAGILPATTLEIPDKRNVTVKDVL
KENSIEAAEEMFLQLKYDPKSVWGYVELHIEQGPVLEQVGFPLGVVKGIAGQTRLKVTVR
GSQGHAGTVPMSMRQDPMVAAAEQIVLMESLCKHPEEYLSYDGRCSGSSIKSLSSSLVCT
VGEISTWPSASNVIPGQVTYTVDIRAIDDLGREAVIYDLSNRIYQICDKRSVSCVIEHKH
DAGAVICDPELSSQLKSAAYSALKRMEGDIQDEVPTLMSGAGHDAMAMSHLTKVGMLFVR
CRGGISHSPQEDVLDDDVWAAGLATLSFLENL
Download sequence
Identical sequences A0A072V6Y9
Medtr2g035405.2 XP_013463121.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]