SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013469170.1.50012 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013469170.1.50012
Domain Number 1 Region: 109-192
Classification Level Classification E-value
Superfamily BRCT domain 1.13e-19
Family DNA ligase 0.06
Further Details:      
 
Domain Number 2 Region: 922-1009
Classification Level Classification E-value
Superfamily BRCT domain 0.00000000000000349
Family BRCT domain 0.015
Further Details:      
 
Domain Number 3 Region: 1151-1220
Classification Level Classification E-value
Superfamily FYVE/PHD zinc finger 0.0000000000082
Family PHD domain 0.0057
Further Details:      
 
Domain Number 4 Region: 8-92
Classification Level Classification E-value
Superfamily BRCT domain 0.000000000174
Family DNA topoisomerase II binding protein 1, TopBP1 0.031
Further Details:      
 
Weak hits

Sequence:  XP_013469170.1.50012
Domain Number - Region: 1034-1114
Classification Level Classification E-value
Superfamily BRCT domain 0.00247
Family DNA topoisomerase II binding protein 1, TopBP1 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013469170.1.50012
Sequence length 1243
Comment DNA replication regulator dpb11, putative [Medicago truncatula]; AA=GCF_000219495.3; RF=representative genome; TAX=3880; STAX=3880; NAME=Medicago truncatula; strain=A17; AL=Chromosome; RT=Minor
Sequence
MLETSHSSRVFRGVHFALFGFDHLTENKIRFKLVNGGGVDAGKNTGNCTHVIVDKIAYDD
PVCVAAREDGKTLVTALWVEHSADIGMPVDATSVMYRPLKKLDGIPGAKDLVVCLTGYLR
QDRDDIMTMVGLMGAQFSKPLVANKVTHLICYKFEGEKYELAKRLATIKLVNHRWLEDCL
KDWVLLPEDKYNKSGFELEMMAEEAKDSEDEAEDSKLGQSGGRTISKSPLGSKFGTTATH
GLSKPLREEASNAIPNSTGPQVFPNANKGKDSSITTGNKNNSGQDVDLNNIGDLKVSCQV
PDVSLHSTSCQLPESYVRTIESKNADFPKAPGFQGQDQDITGNINSSGLRPNLHGDNLET
KISYTRSTSTSADGLAHSDEKLGATSYSRKNQKEFTFSRVVDQYEGREGNSLETPSTKVE
KTSEGIKSACVEGSGNETGVIQEVYRNNSLPQKRTNEAASSTKLKSRKITSNAKLSIEKT
PLTNGKSQGLKVPSVVDEPPVSDGFLSVDKDGINNLNTCLISKSAASASNSVAFDKPISG
NAESAQLDNAYQNSAQKTVQSLNKSKIGGEPDVTGFGKGHGDNEEEQLNVTTHLECSSPG
KNSKNEGFPGLDNLDLSNEESNKLIRKSPRKKSAAKRTLGSRPRKGVTAKLKSSVCLNKT
TQQDEGVSSSGRSKEIATSGAKERQASPQILDVNKLMEQKPVNGYAEGAGGRTDFLDDET
EAPDDKCESELGMAPNEELVHLSKKVDTSTEEKLEAVNHDKKCEEPLPPKKVTNETKKQN
LPSELDSTSKLKVKHQAIKRPASKTKKTTVAKRLAKSEKAVFGEKIPNETRDEAEIKILK
EMSLSVPSDISENSNAPKNKPENFIEEEKENRPNDGEHGLEERRNVRTTKSSVKPANIKS
KEMKHAPSTSEFNARVKPETTCFILSGHRLQRKEFQQVIKRLKGRVCRDSHQWSYQATHF
IAPDPLRRTEKFFAATASGRWILKTDFLSASSQAGKLLPEEPYEWHKNGLSEDGAINMEA
PRKWRLLKERTGHGAFYGMRIVVYGDCFAPPLDTLKRAVKAGDGTILATSPPYTRFLDTG
VDYAIVSPGMPRVDLWVQEFLKHEIPCVVADYLVEYVCKPGFSLERHVLYGTNALADRSF
AKLQSKAEEIIEEVIPHEECDNDDDDVACQVCGSRERGDVMLICGDESGSVGCGVGTHID
CCDPPLAAVPEEDWFCPKCSSTQTCSKKANKRKKGALSSSKAK
Download sequence
Identical sequences A0A072VP53
Medtr1g087290.2 XP_013469170.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]