SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013618648.1.26608 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013618648.1.26608
Domain Number 1 Region: 29-210
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.7e-69
Family Inorganic pyrophosphatase 0.00000441
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013618648.1.26608
Sequence length 214
Comment PREDICTED: soluble inorganic pyrophosphatase 1-like [Brassica oleracea var. oleracea]; AA=GCF_000695525.1; RF=representative genome; TAX=109376; STAX=3712; NAME=Brassica oleracea var. oleracea; cultivar=TO1000; AL=Chromosome; RT=Major
Sequence
MSEEVKENQSGKLQKPTPRLNERILSSLSKRSVAAHPWHDLEIGPGAPVIFNVVVEISKG
SKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVIMQEPVLPGCFL
RARAIGLMPMIDQGEKDDKIIAVCVDDPEYKHYTDIKELPPHRLTEIRRFFEDYKKNENK
EVAVNDFLPNGPAVEAIQYSMDLYAEYILHTLRR
Download sequence
Identical sequences A0A0D3AS94 M4CWF4
Bra008551 XP_009128516.1.100322 XP_013618648.1.26608 XP_013719426.1.73403 XP_013731710.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]