SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013634673.1.26608 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013634673.1.26608
Domain Number 1 Region: 30-211
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 3.14e-69
Family Inorganic pyrophosphatase 0.00000512
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013634673.1.26608
Sequence length 216
Comment PREDICTED: soluble inorganic pyrophosphatase 3 [Brassica oleracea var. oleracea]; AA=GCF_000695525.1; RF=representative genome; TAX=109376; STAX=3712; NAME=Brassica oleracea var. oleracea; cultivar=TO1000; AL=Chromosome; RT=Major
Sequence
MSEETYEETMESNESPRPAPKLNERILSTLSKRSVAAHPWHDLEIGPEAPLVFNVVVEIT
KGSKVKYELDKKTGLIKVDRILYSSVVYPHNYGFIPRTLCEDNDPLDVLVLMQEPVLPGC
FLRARAIGLMPMIDQGEMDDKIIAVCADDPEYKHFTDIKQLAPHRLSEIRRFFEDYKKNE
HKEVAVNDFLPSEKAHEAIQYSMDLYAEYILHSLRR
Download sequence
Identical sequences A0A0D3BNQ1 M4CJW8
XP_009142592.1.100322 XP_013634673.1.26608 XP_013710370.1.73403 XP_013751994.1.73403 XP_013752019.1.73403 Bra004502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]