SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013645321.1.73403 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013645321.1.73403
Domain Number 1 Region: 201-265
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.00000000000012
Family DNA-binding domain from rap30 0.0066
Further Details:      
 
Domain Number 2 Region: 32-148
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 0.00000000000034
Family Rap30/74 interaction domains 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013645321.1.73403
Sequence length 268
Comment PREDICTED: transcription initiation factor IIF subunit beta-like [Brassica napus]; AA=GCF_000686985.1; RF=representative genome; TAX=3708; STAX=3708; NAME=Brassica napus; cultivar=ZS11; AL=Chromosome; RT=Major
Sequence
MGISEMQKKKIQRKKLHEEEKILSDLMELAVEDNQGLETEKADEMVWLMKCPPRVDKAWR
QLSSSSSSFSQELVLVAKYSESVDLLLPDLSPELSMEMASAELCNISKLYSVSKSSDFVG
PMNLFSESNQGKLAVEGTVTHKLDMRPHDCIEEYGKLLRQRNKKPVAENRCIQVIDDSRG
EHLMPKPPLVTKKLKKRDKRTRSDRSEVEAKMFQLFEREPKWTLRQLVKKINHPEIFLKE
ILKELCVYTRTRSGHSYELKPEYKKSKD
Download sequence
Identical sequences XP_013645321.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]