SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013746046.1.73403 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_013746046.1.73403
Domain Number - Region: 34-78
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 0.0847
Family Polyphosphate kinase C-terminal domain 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013746046.1.73403
Sequence length 114
Comment PREDICTED: major pollen allergen Ole e 10-like [Brassica napus]; AA=GCF_000686985.1; RF=representative genome; TAX=3708; STAX=3708; NAME=Brassica napus; cultivar=ZS11; AL=Chromosome; RT=Major
Sequence
MSPFSTLIVILVSSIMIHHLPLASSTQWCVASPTSKEKQLEENLGFACANGVDCRPILEG
GACYNPNTPLGHASYVMNAYYATHERTDYACKFFFPNSAMLTTTNPSYGSCVYA
Download sequence
Identical sequences A0A078IN52 M4FFX4
Bra039998 XP_013746046.1.73403

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]