SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013755135.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013755135.1.50528
Domain Number 1 Region: 3430-3612
Classification Level Classification E-value
Superfamily I/LWEQ domain 4.12e-40
Family I/LWEQ domain 0.00016
Further Details:      
 
Domain Number 2 Region: 1317-1430
Classification Level Classification E-value
Superfamily Second domain of FERM 1.31e-27
Family Second domain of FERM 0.0000315
Further Details:      
 
Domain Number 3 Region: 69-139
Classification Level Classification E-value
Superfamily PAH2 domain 3.79e-22
Family PAH2 domain 0.0013
Further Details:      
 
Domain Number 4 Region: 1431-1524
Classification Level Classification E-value
Superfamily PH domain-like 1.17e-21
Family Third domain of FERM 0.00024
Further Details:      
 
Domain Number 5 Region: 196-265
Classification Level Classification E-value
Superfamily PAH2 domain 1.57e-18
Family PAH2 domain 0.00023
Further Details:      
 
Domain Number 6 Region: 1914-2042
Classification Level Classification E-value
Superfamily I/LWEQ domain 1.69e-18
Family I/LWEQ domain 0.00097
Further Details:      
 
Domain Number 7 Region: 3717-3776
Classification Level Classification E-value
Superfamily VHP, Villin headpiece domain 4.97e-16
Family VHP, Villin headpiece domain 0.00051
Further Details:      
 
Domain Number 8 Region: 1822-1937
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000000000000105
Family I/LWEQ domain 0.00044
Further Details:      
 
Domain Number 9 Region: 2386-2514
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000000033
Family VBS domain 0.011
Further Details:      
 
Domain Number 10 Region: 292-359
Classification Level Classification E-value
Superfamily PAH2 domain 0.00000000000131
Family PAH2 domain 0.0038
Further Details:      
 
Domain Number 11 Region: 2985-3109
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000000000157
Family VBS domain 0.0096
Further Details:      
 
Domain Number 12 Region: 3147-3267
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000000000022
Family VBS domain 0.012
Further Details:      
 
Domain Number 13 Region: 1671-1807
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 0.000000000706
Family A middle domain of Talin 1 0.0011
Further Details:      
 
Domain Number 14 Region: 2840-2952
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000596
Family VBS domain 0.057
Further Details:      
 
Weak hits

Sequence:  XP_013755135.1.50528
Domain Number - Region: 2041-2158
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.000157
Family VBS domain 0.021
Further Details:      
 
Domain Number - Region: 1235-1287
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000728
Family Ubiquitin-related 0.036
Further Details:      
 
Domain Number - Region: 2591-2694
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00129
Family I/LWEQ domain 0.0037
Further Details:      
 
Domain Number - Region: 2701-2811
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00369
Family I/LWEQ domain 0.0035
Further Details:      
 
Domain Number - Region: 3310-3419
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0173
Family VBS domain 0.014
Further Details:      
 
Domain Number - Region: 1161-1236
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0285
Family Ubiquitin-related 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013755135.1.50528
Sequence length 3776
Comment hypothetical protein AMSG_12193 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MSGTSLEANESLDMSSPARGDALLAPTNESLDESTGPVEMETEPVAAAEQAGTGADGSMA
APQAGVEASGQPKVEDALLYLEQVKIQFREQPEVYDAFLDIMKDFKAHNIDTPGVIQRVR
TLFRGHRDLIFGFNTFLPPGYKIELDDLRDEPEPPKRASSSTARPAKKGGRKKRVSNSSR
ARRGGMRKRDGVSAAAEPKSLDTALNYVNKIKQRFESNPEVYTVFLEILQTYQREVRTIT
EVYDEVSRLFANEPDLLEEFTTFLPESLAHHNRRKRGREGASRGRPLKRAKIELAPDDEI
GFFNAVKRRLTAPLYADFLKALHVFSNQILSTAETVKLVRTILAGHPDLISWFEAFVDYK
EQGAKMRRVQSISQIDNDEYIDYSQLKKYGPSYRALPTSYRRPSCSGRDDLCDSVLNDTW
VASAATDSDDFIFKSSQKNEFEERLFLCEEERYELDMVIEQNASAIRALEPLASKILEAQ
KQAGTEGPGPSFKLASENALGIIQIKAIERIYGHRAKDALSGLRKNPHVAVPIILKRLRQ
KDRDWRRIQREWNKVWNNVNADNYRRSLDYRGAEFKTSDKKSMGTKALVSTVKEKQDQLK
VQGKATAVHFTSTIESTAEIQEAYRLLLFCLTRSMATDKVVQKMRLFIVGWLAKFLGVPV
ETSVIDEHFAQIRKALARKHTPSGAAASAATAAAAAAAAGAPAPAAAAANGPTAGSIAEG
LPPPVAAAVAEAAAKIDAAEEEVAQMRSTSTAPQPPFFGNEIYFVVLQLFALLTSRIAKV
RELAVVAQGKYDAAGAQAFRKPFNKAAAMLDPTYAKRSDTALEAMDVAAAGGSVFAAVLN
FVKLYQASKVSTSRFENTLNDVLGPDSYQLFTMDRILTQMTKMINSVVGDDLCARLMALY
NYENGRTRNTDSSYRVSALLMMPEMTTFRLKVSQYARGSRSLLVWVIPEDSPGTMPVFSS
SPASPPEASAMLAKWSEYMRTFIQPTVNPHIDVRAHNIFLPRNLVTSRSLDDPELVIQHG
LAAKIDFDSYKMVYLCGTEDWLYRRGALAAAVPRFNSSPNNWWAKLHTPDPARPDPPVLD
RTNIKPEYVDSDDDDVVSDSNTNASNNETKPVVTSVSVPVKAPASVPGQPPPAVPAPTGD
AVPTSAVTGAVPVPPAPVAAVVLKVRVAKTGAVKSMPFNPSMSTGEVCREIRDRVGEGGS
DHGLFKVGDDYSVGKWLENNKTLNYYELRSGDLVEFKKKHRPLRVQTVDGAVKTVLVDDS
MIVSDMVAIIAARVGIANAEEFSLKKVDSADNEWLNPGQTLRDQGLEETDPVLLKQRFHY
SDQNVDTSNPVQLNLLYEQSREAILTGKYPCTQAEAIQFASLLCQVTLHDHNPAKHKPGS
LDLKNYVPGEYVKAKKIDKTILSEHRKLIGMSELNAKFRFVQLCRSLKTYGVTFFHVREQ
VSQGKKKKKLVDRLLGITREKIIRMDAQTKEVVKSYPLAHLKRWAASTNSFTFDFGDYEG
SYYSVQTSEGEAMSQVISGYIDIILKKKKQAGRYVVDDDEEQTVVEEDISAMKAQAISRT
PSNMQYTSAVNLSRAGMVQGGASGYQMSSAGAQYGTAQTPQSQNAAGGWKGQFTRGSAGE
LESFTTGNAAVLNASGLGGLLKDLEGAFASVNAACNELAIPVTKSPMGDSDDPMARQWRQ
KAMQGTRQQLRQHTDGLTVATAQVVGSAVCATPDQFDPDTLAASCKALGNHMAQLATLAR
TAASLVDDAESGQLMAASRQMGDATKRLVAAANGAAGGLSQSIVDPKLREEVLASAKDIG
KLVNQLLAASGASEVDGAGQTKMFERTAAVAQAATKLVNDAKQVANAQSTDEARKLVNGG
AKHAWTATSQLVACVKVLAPTVASAKSKQQLEKSAALVRSAVGGMIDKAGAAGVDAQDMS
KLKVACQGVNQALQQLLDAARTVGDRPDFTAQYAKAAAVISAASRKLVNANGNPQEIIAG
AKAVGQGSAVMIKFGKAEAGHETDPGVQKALVDATRRLADATSALMRSAKAAASNPSDGA
AQDQLANDARELDIQAQDMLANSQQRLAMRNLAEATQEAISKTAALIQASKPAASANSNA
AAANGLIDSARQTAEKVTGLVNALKAHQASPDNSTMQGKLVTAAKVSCPAVAGLVNASKQ
AAPSVTDPTAQQNLASSAKGCAMAMQKLLGALKEAKSLQGGLEFDTAMEQCNAAKEQMKS
TAQRASAGTLVPEFGTTPQSSYENYMAARRAVHNNLDQLLKSSQEKDQETAAIAAKDIGS
AMRGVGAAVEGVAATSDDPTLPGTVTDAGQDFADKVITALAAAKACANDPENDAKVEQLL
QAVATAKGSSEAMTAALPGQREVEAAMTAVRAHCDLAQLPALQAGESQKTFQDSFLKAAR
ALAQACQGLCRSVERGPDELAQAANGVESTTARVVAAAGGMAAATADPETKQQIVDTVGE
LGESIQDLLEASRGAAADPNNAESKSAINDSHLAVTDTLNELSSLFQAAGPGQKECDEAM
KAIKKAAAQIEAAVVPSSMAGKSYGQIQGELKAAAKELVRGTGQLMQAAKKNPAAIPTAA
DTLTGAVSTITAGSSAVAQAVGDGGKVTVERFTIPQEAIKDSVNELRMANGEPKKIIGGC
TGVAKSTQAIIAASKLASRQVDDPEASQQFMDLAKAIAGATAATVGAGKAVARSNTPENN
AELLAQSNALQNSVAQVVALAEDHLDHSQVSPETKQLQKEILANGKEVAGNTSQLLGAAK
LTAMSPQDVQCNQDMLACAKSLSDAISDLLTSIAGAAPGAQECTNAMDVAQNCISELDTA
AMSASVEALDREEGQTADGCSAALATTASELSTAASKLAAAAASSPNEIGPVASSIAILL
PDLTSSTVGLAACTADPVKQQATLARGKDVSEAMYGLLMTTKEVGGAADDMEGQMRIEQS
SKDVSNALAALMGDVSGEMASSQQVQQAQLAAKNASSVLNGPYDTSKDYRAFNQDIVDQA
RTIAGAVSKLSTTAKMNPDGVGAAAENMAASLSPMMAAVNGAAQTAPDEATKNMLLDTAE
NLCSESAALLVRAGELSKEPTSFTKQQSVSSSAREVNMNVAKLISATKAKSSAVKGCEAA
IESIQAAVHDMDTAAMFASMGQLEREDGGQFSKYRTELMTESKALAQGSAGLINTAKTSS
ASLAPAAEDAAGKVNAIVDAAKHAAATVFDPELQRQLFDSCRSVCNSTASLIDASRSVHD
APNDQALVSTLNASGKEFADNVSAFVAKIKEVDGENAKGVTAATTALDAIRSAVPEVTSA
SPPTVEPSVEAMVDASKKVAAVSAQVVSAMRSSPEALAVAATAAQDATLELLVQGKAAST
DGDADAQEPTRTAVVNAANAIAGVLDVVVAAGGNSTSPAVGEELAAAARGVADAVADVVE
KARELRADFVDMSDPNMVAEKSLLDAAASIEAAAQKLATLVPRPPVNMPDMDMAFEESIL
EAAKAIAAAVAALVKAATEAQREIVANGKAAAGGKVYHADAVWQEGLVSAAHAVAAATSE
MCQAANDAAQGEGSEVSIVAASEAVSSTTAHLVAAARAKMDPNSRNQARLEDASRAVRQA
TSSLAESAKMYGDKMAEMESANAMMAVDSNSSAVARMRQEREARERVLRLERELEAARRA
ATEQNRSRYTEGSSSAAPAPAAKPKPALAAKPKPAPAAKPKPAAAAPAASSGGAAGTTYS
LAELQSATLPPGVDPARKQDWLSDADFQTAFGMDRAAFAALPAWKAETLRRKAKLF
Download sequence
Identical sequences A0A0L0DKH9
AMSG_12193T0 XP_013755135.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]