SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013755595.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_013755595.1.50528
Domain Number - Region: 22-54
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 0.00105
Family Catalytic subunit of bi-partite nucleotidyltransferase 0.08
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013755595.1.50528
Sequence length 247
Comment hypothetical protein AMSG_08265 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MTAASAAGYAERVLAVLGVAYSRVLLARFNGSRGHGSDDAESDVDVYIVYAPSTEEVLVA
GLEASVAPPDTLTTSIEAGAGPGIEKTTDVALYEVGKFLALLRAGSPLAVETVFAPSEDV
YVDPLLAPVLEMRDEVLTRKAFRSLLGHTSSEFKQIELAEARGVGWSKLLYHAQRLMLEV
EAVYSGGRPQVKFSGETLAALMATKQGKLGGAGEAALLEKLRSRHQQLQRDDPTPAHLPQ
ALPVNNS
Download sequence
Identical sequences A0A0L0DI75
AMSG_08265T0 XP_013755595.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]