SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013755949.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  XP_013755949.1.50528
Domain Number - Region: 3-41
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.000497
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013755949.1.50528
Sequence length 141
Comment hypothetical protein AMSG_07447 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MGEYLAEHGIDVFLNDALTLAAEVLPEKPAAFLAAYFDAVDSGTHVLGRSMEFITACAYN
AMSAGSAWREAYAGLDASMLLSGGDAFELTVRLFPDLPQEVVEAAMARSDREVEAGVTVA
SFAQLLAAELNSRVAHRLPPR
Download sequence
Identical sequences A0A0L0DGU3
AMSG_07447T0 XP_013755949.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]