SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013756452.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013756452.1.50528
Domain Number 1 Region: 567-683
Classification Level Classification E-value
Superfamily Second domain of FERM 8.11e-17
Family Second domain of FERM 0.001
Further Details:      
 
Domain Number 2 Region: 1119-1225
Classification Level Classification E-value
Superfamily Second domain of FERM 0.00000000127
Family Second domain of FERM 0.0063
Further Details:      
 
Domain Number 3 Region: 492-571
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.0000000115
Family First domain of FERM 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013756452.1.50528
Sequence length 1284
Comment hypothetical protein AMSG_06949 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MNGEESSEYSLVSDEPPEVLSLSADRSESPHDLARHARDMTWAEAAGSQPPTASSTSRSA
KGNSERSEPGTTTQSFTRPGHAPSHPHAALSALNSALSSATPYTASADASGSSNVGRLAD
HQSSGSSTPPPVITLAETSPARAVPGSKMRRSRRGAGADGLLSVHSGGAKRKFDPWASAA
TPPRSHAFDDDDDESYSLSSDLLVSPYREPSPAAHFAALRPAALSVAGGVRAPDSSSSPL
SYSATPSVSSPASAKSLAAPFGASTTGDEDDEYTISDSGDPLGGGVGHIFDDDGLGSGSD
SGSGSDVEQKAYGHSFGSSNAAYNDEIAESSGMRSVRGRVATPHPRDDGAFSFDTRDTSR
ASKLLEEARHPRRGDGARDVPSPEDELDSDSDDGPPLAASPDVDPGTLLALINADLDANT
YRNSQPPGTSSSEVIDDEVDPDGVLREARRSSTAGKRVLFGNNFVPKTRCGILRAPRTRA
AHAVRTCTFKQNVKIELPDESYIRLNCLTSTTVKQVIELVADQLGIVQREYLGLLEYSVQ
GYECWLKPESSLLRQVKFVVPSVKFMFKLHPRTIDELTDPLAIQLLYHQTRANLVSGLYD
AELTKSVALEMTANAFQATFGDHVEGLHIPGFLTRPVTLSMFLSRHILRKYRNKVWQKRI
FAVHQLLRGMSKTEAMTAYLRHAAESIPSFSMEYFHVHNATNKAAITLCIGPEFLEVFRK
SRSLGTHSYRDIFRVVLESCGRGTAKRYRITFKIGIVNSPDLPDSAIAPFMVTTDNTTDA
ELILALVQSYTLLYKARARSGGRSRTSSRAKRTRFSRVASHDAIASELGSLYSTPRAISA
GAGLQSSVLLAASSLGGSMGSIPELHSPSGGARNSFAFDGGSGSGSGSDGSDPDVAAAAA
ARDAVRRMSRQRSTDSIGRHGSGLPSRSGRRRANSHGMDQSGRVRGRRKRSSSARESTHG
ELGAHAAEARRAEAAQAALAAKAARDRRRRPGPPGRELLSRDSLQVIQLEAAVSGTLPNV
RVALGDGSSVRALHAEPGTTAIELYKQYRDMLDLADFVELHVVVAAASLPTLAGLVVSPD
KQWVWVEPAEPLLPQVLAADETSRRQVQLVVRIRSFLGFNALELSDYETIHAAYLHVRGQ
LLHGEFDAELDMPIMIRLAALQVQARRGNWDESDEVVVDVSTVAPPALAPKLAAADVVLM
YQSLAARPSIEAERAFLDITSTLSNFGAFVFPVDVAHAGKALDLLLAPDAHGLAGPDRKV
VVMGLATAYEAADLLSCLFAHDAY
Download sequence
Identical sequences A0A0L0DFP2
AMSG_06949T0 XP_013756452.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]