SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013757954.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013757954.1.50528
Domain Number 1 Region: 234-325
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000000379
Family Second domain of FERM 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013757954.1.50528
Sequence length 572
Comment hypothetical protein AMSG_05227 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MAAAATSATAPAMNTNEEEDNSGEMMAVTLTLGPRGSDTHRAMFPASATANEVLATLDAV
AELDIDPQRVALLIPGAAEREAETAELSAEEMSMQKPRLLGSRSAPRWLAGEARLGSARL
GHEPRLSLRRRTRRVRILVTSFSKVLRYDVCAPVGELLAAFASRIALANPEEFGLTMVGL
GPHKWLDLTLPLHCQVWSPEVSESDDALIQLKFRRRLYASHLDLSACVLPVVSLEIADDV
RAGRYLVDTAKAVELTALHLAVYAPRELTALPSPLDEYLPAQVVEAVRSDELHARILARH
AELRQEEGRALAEAYVQAAAALPLFGATRIECGENGVTLSIGREHGLVVLDGMYGTSPPP
LATLDIAEWKAGERGRPTQSAIIDIVALEAIVGWRHTSRTVTLVLGSEPEREVTFGTARA
DEVVHQLERLTELLSAETGQRAWEQAEWTDGMHVSPMFASGEHEFQPELFEVDLLRPRGG
GAVIDGSWAPGAPTALELTLVLHALIGGAAALSAAGDGESVHRRMWLAWAAAAGAVRLLA
AVSPHEFGLFLALPPIRLFCLDGCSHLLEQSQ
Download sequence
Identical sequences A0A0L0DA67
XP_013757954.1.50528 AMSG_05227T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]