SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013760949.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013760949.1.50528
Domain Number 1 Region: 934-1254
Classification Level Classification E-value
Superfamily RNI-like 4.12e-52
Family 28-residue LRR 0.012
Further Details:      
 
Domain Number 2 Region: 52-143
Classification Level Classification E-value
Superfamily Ankyrin repeat 1.39e-17
Family Ankyrin repeat 0.0024
Further Details:      
 
Domain Number 3 Region: 862-920
Classification Level Classification E-value
Superfamily RNI-like 0.000000759
Family Rna1p (RanGAP1), N-terminal domain 0.061
Further Details:      
 
Domain Number 4 Region: 472-586
Classification Level Classification E-value
Superfamily Second domain of FERM 0.000044
Family Second domain of FERM 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013760949.1.50528
Sequence length 1282
Comment NOD3 protein [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MAPQHTRRFAACRWRFSNVANPDIGKGTFLSHMSDAAPTDAIAVARSGNLKNLIELVKAS
GKKSVTEAVEEGTGNTALHAAVESGKSKMVTAVLKLGLDIDQVNNDGNTAFHLACAAEAS
SIAAALLKAGADKSLKNNDGKTATALLKAARKKSTAAAGDTGAASASAASAGGEGEGGAG
SDAGKKKVVKKKVVKKKMIKKKVIKKKGTKKVIKKKKVTKKASAKAAAGEGTDAGTDAGT
DAGNDADNGGPDGSADTVEADTVKAKAEPKAKAEPKAEAEPKAEAEPKAEAEPRAKTTTS
STKATAKPASATATATSSASASASASASASASASAPVTITSMTGMDDESGAAHLDPKLAK
AVAALKTSFTQRASILEAAPPAGTGATAMIMKPQCKSSYSVDYDPATATVGSLLVSLAAQ
LDIPYPEAFRITLGKSPVDAKPLDDATLVSSLTLGGDDVLVVRMAHEKPLSDYLLATSES
TLSLAYLAAVENVSAGLWALPSHGVAFRLAGIRVVVGCGSIKSRPKVQSFVKSLLRTVLP
PALIAAKLPVGYLVTRVVNVASAVDELSKSKLMRMFLSVCYSLPRYGMSRPISVTTQVDP
LVTGKMALTHDGIMIVMNDALPPPRYAQFLPYGSITGMTTGADGQLTLTLRRQIADASDA
ESGGPSASSISVTLHLVETPSLRDEVVSEIATWMALNMLTENPGPAYALTSALPAVDEPL
PRAWLVYEPPSSSLPAFGGGYRRMPDAPFLTRLEAFRAFLHKRLERAGLEPYPPLEECIN
AAEDAAAPLTAFDLTGSSEVAAYLEHVGRALVEALSYTPPFPRVYFAESLRVSKIDLSSA
SLGGESRNLDAVARFFSEFGGRDLAHLLNIEELSLANNGISGGEWGKVASAMRPLTPLSV
LDVSYNPMGAAGMEDLVKSINDRSGHVTKEWRAHHVGLSDAGAEAAARRVFANTAMDTLD
LSYNDMSDRGTTEVLEALERGRGVSEVNLSGNIIGSSAAKVLLKLATERSTVRSWLLDEC
DVPAKVATALAERVATGLVKLSLNEAKLGKKALAPLLEGVSQRNSLCHLGLAGNKLDASW
ATEFAGALGSSSLGNLTALNLANNKLGSDGVSAILAAVGSNSTLFSLNLADNKAGKEIAD
ELASHLERNISLKKLNLSGASFGDAGAEALSHALAQNRVFLEILRLDECKIADVGAIALF
DALKTNTRLQKLWLTGNKFKGTKEHKSTLLELVETTESLDTIDLRNNSKLDNWGSQAKLA
AKKASKALGGHFTCTVHVGDLP
Download sequence
Identical sequences A0A0L0DW80
AMSG_02407T0 XP_013760949.1.50528

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]