SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013761279.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013761279.1.50528
Domain Number 1 Region: 167-505
Classification Level Classification E-value
Superfamily RNI-like 8.63e-66
Family 28-residue LRR 0.0093
Further Details:      
 
Domain Number 2 Region: 50-223
Classification Level Classification E-value
Superfamily L domain-like 1.67e-34
Family Internalin LRR domain 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013761279.1.50528
Sequence length 535
Comment hypothetical protein AMSG_01764 [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MKMTMGVLLGVLVMAMVVVNVVAGHPSYMGATPRCQEIMTRMRGADWPSEVLDLKDCYLK
YLPAEVGLLTHLTKLDLTGNDLDELPFNFGNLVNLRELSLWANEWEHVPEELKGLKSLEV
LDLSYMKLKVLPEWLATEFPKLKRFSAHGNGITKMPDSFASLQLEYLNLYNNSLHELPSW
ICEMTSLKELHISHNEIATIPDCIDNLVDLEVLGLWDNDIHTIPESVGNLRNVRLVSFAG
NALHSLPDNLYNHWTHIDDLDLSNNEFSSIPAVVLSMSHIKELHLHGNYLTSDKLPADLR
SLPNLEYLSLGHNRLNSLPPNFLAGLSKLRRLDLSHNSFTEFPAAVAAVAPQLELFNIHV
NDIKSIPDNVLSSMTSMQKLDLRETGLTSLPTSLGTLTQLEVLDIGNNKIGPRLPNFLAS
LVNLRKLAIWSCGLTELPSWIGNLRNLEEIDFSSNDITSFPKSFELCSKLKVLHMHYNQV
SHFPEYLGTFSDLEVIDIYDNPIQHLPTGFCDGSHPVSERMAYWCFALAGGHDEL
Download sequence
Identical sequences A0A0L0DT17
XP_013761279.1.50528 AMSG_01764T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]