SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013761651.1.50528 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013761651.1.50528
Domain Number 1 Region: 175-284
Classification Level Classification E-value
Superfamily Nucleotidyltransferase 5.14e-21
Family Poly(A) polymerase, PAP, N-terminal domain 0.084
Further Details:      
 
Domain Number 2 Region: 315-485
Classification Level Classification E-value
Superfamily PAP/OAS1 substrate-binding domain 1.96e-19
Family 2'-5'-oligoadenylate synthetase 1, OAS1, second domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013761651.1.50528
Sequence length 566
Comment PAP/25A associated domain-containing protein [Thecamonas trahens ATCC 50062]; AA=GCF_000142905.1; RF=representative genome; TAX=461836; STAX=529818; NAME=Thecamonas trahens ATCC 50062; strain=ATCC 50062; AL=Scaffold; RT=Major
Sequence
MAGVAEPRHKQEEAEVWPHDEGCTVEKPPCGKRKKRRRRRYRVFYTHDDKYLGQVEAPSR
GSGPPAPTAGKVRSGHAVRYVARSGSGSDGASSPASETNLATTVSRRSWTATESVQLSGL
ATPADDAPPTTMPATRPGLGTAGLANTVPLPTTAPLWFAHLGGVDYGGPGRGRVRRMLRG
LSLEIESLAKMLAPTPAELELRSRLVESVRAAAGAMWPGAAVHLVGSSATSMFLPDSDLD
LVVVGVSSDGLGRLYHMADALRAVPGVVEVEVLSAATVPVVKASLAYGFGIDVVFDITTG
VETVARMGPLLAAYPLVRPLALVLKHMLRTHRLNSAYSGGLCSHGLVLLLISMLQFMGQV
SPKHVFHSCTPPSPLPAVVTPPTTAASLPDDQALGFCFIHFLRLYGTEFVYDYRISVADG
GVLSLCAEPDGPSAAEADGPRIQLRLEDPVSGGDVGAGAFMYDVVRSLFQAKYYAMAHAV
RSSSLTSLLALVIDPSEFAVYARWRHSVLYPTSPPDAAPPVSPMADHTAATTRPRSKSSR
SRGGRRHRNRNRNRAQRPSQDVDQGI
Download sequence
Identical sequences A0A0L0DRV2
XP_013761651.1.50528 AMSG_01602T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]