SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013774505.1.66592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013774505.1.66592
Domain Number 1 Region: 282-373
Classification Level Classification E-value
Superfamily Immunoglobulin 1.19e-19
Family I set domains 0.017
Further Details:      
 
Domain Number 2 Region: 194-284
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000421
Family I set domains 0.032
Further Details:      
 
Domain Number 3 Region: 12-76
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.00000000000277
Family Ovomucoid domain III-like 0.02
Further Details:      
 
Domain Number 4 Region: 120-182
Classification Level Classification E-value
Superfamily EF-hand 0.0000000000599
Family Calmodulin-like 0.064
Further Details:      
 
Domain Number 5 Region: 432-716
Classification Level Classification E-value
Superfamily 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.000000000575
Family 3-carboxy-cis,cis-mucoante lactonizing enzyme 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013774505.1.66592
Sequence length 778
Comment PREDICTED: follistatin-related protein 5-like [Limulus polyphemus]; AA=GCF_000517525.1; RF=representative genome; TAX=6850; STAX=6850; NAME=Limulus polyphemus; AL=Scaffold; RT=Major
Sequence
MELGKENPCDAVTCGVGRQCEVSDAGQAVCICRLYCKHHNKPVCGTDGNFYNSHCELHRA
ACLEDKIIRIDHKRGCLKKRVRECVQQEYDFMKENILLFNNDELMDNKKSGRGNEYLVSI
MFSHYDQNNNGYLEAEELWQAGERDHLGHLSTVCILADMLLYDDTNHDGKLDINEFYLAF
SVSVVSLDKSLEVNHVMARVGDNVEIKCDVSGTPPPPIVWERNNLDLSILNEDEIKVFVD
GSLYLTNVQLVHGGNYTCYAQRNRDIFQTHVLHVQTLPEVHVIPKLQSRSPGELAEMECH
VAGVPTPKVSWLKNDDELKMGANKYTIVGNGTALLVGKVTYSDTGAYMCVASNPAGSMRD
ISSLVVQDQPTPIFPYFFLAAPFEEKRFFVFHDWGVSVYDPENCRLYHQIQSTDIIPGTQ
EYVCGDRGINCSWGSAINVANRYVYVSQPTKDRILIISRVQMVVVDVVVTDKYPVDVHYV
PHLDQVWLTCWRGPEDQGSKTIQIIRDASQKRKHHTVHPEPVDGHFDLVNELFIPLTQEL
QHPWKYGFVVHTNQRGMYKLHLKGMKYVKTVDLTPYNCEPHNAAFAAFGGYVVLECIEPI
THRPTGQLVLDYLTDTVISHKINLFGQPHISPDSRYVVTLERTNTSVIMIAQEVTEQGLQ
FLFDVRTTLHISDITYFPSRTTQSYDLYASSSNKEDILFVDLANGKVEMITGIGQAMDPG
VAEWKNTNRPMSSAGIFGTYMVTTANEAIFVVNGKTRTVNCEIGSIVHPRMVVWVKSP
Download sequence
Identical sequences XP_013774505.1.66592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]