SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013786520.1.66592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013786520.1.66592
Domain Number 1 Region: 63-520
Classification Level Classification E-value
Superfamily Sema domain 1.44e-112
Family Sema domain 0.0000441
Further Details:      
 
Domain Number 2 Region: 1403-1529,1717-1866
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.45e-39
Family p120GAP domain-like 0.023
Further Details:      
 
Domain Number 3 Region: 878-968
Classification Level Classification E-value
Superfamily E set domains 0.000000000000267
Family Other IPT/TIG domains 0.013
Further Details:      
 
Domain Number 4 Region: 974-1058
Classification Level Classification E-value
Superfamily E set domains 0.0000000000955
Family Other IPT/TIG domains 0.031
Further Details:      
 
Domain Number 5 Region: 523-563
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000131
Family Plexin repeat 0.002
Further Details:      
 
Domain Number 6 Region: 1057-1127
Classification Level Classification E-value
Superfamily E set domains 0.00000000118
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013786520.1.66592
Sequence length 1937
Comment PREDICTED: plexin-B-like [Limulus polyphemus]; AA=GCF_000517525.1; RF=representative genome; TAX=6850; STAX=6850; NAME=Limulus polyphemus; AL=Scaffold; RT=Major
Sequence
MTSYPGGVGYTSWNVLRQGHQKNFLSVRRTRCFVHCVVWLSCLVFLRLVQTVAALEDTNI
SVSYTTFNESVNFTHIIVDQDTGRVYVGATNWLYQFDSSLELEKEVKIGPVEDSIQCSPT
DCFHQKKMVTNNVNKVLVIDSQAGKLIVCGSVHQGACRRHQLGNINIVEDLVPVPVAAND
ENSSTFAFIGPAQYFSYPSRVLYVATTNSRLGPYRDMVPAITSRSLEEDTGRLFGIIEKS
FSTIARVDISFHLRDYYLVSYIYGFHSGGFIYFASVQRKSHLRALEEWGYMTRLARVCAS
DAGYNSYTEVTLQCVGTDGTEFNLLQDATVGPAGSDLATALQIDTGSNVFIGVFATSADH
TSASSPPSAVCVYSLAEIEQRFTENIHMCYNGSVLARNMDYIAGSIENCPEPGKGGNIFS
FCTETLKLNGTVPITATAVAIFPNVTLTAVTSTTTAKHTVAFVGTDTGYLKKMLINNGED
ADEFEEVAVDPGNPVLADLHLDTTEQFVYVASPYKLTKARIEQCQQYNSCELCLKARNPY
CGWCSLEKRCTVTSACQNATSGFSDSSPRWLSLNTQQCIDVQAVKPEQLPVTSMIMVELV
INQLPNLPFGAHYLCVFGNSATIRAQVTGTGLACMTPRIEDRPSILPHKDHVIVDLAVRS
SETNTDFLHKPFAFYDCSVHETCSSCVTSSWACSWCLHENRCMHNSSSCLRTIITGENSP
QNSLIKGRRYCPSFALKREILLPNGVRKEIALDGKNLPSLLGDFFLFLQDNFQCVVEIEG
AKERVLARVYGNKIICAETVYTYEAEVGQLNATLTVFWHGDSYIDQTIVTLYKCHLLGSH
GGQADCSLCLTRHPKFRCAWCGDQCSYSNSCLETPALTCPPPRIDWIHPLSGPIQGGTLM
AIEGSNLGTSEEEIGNKITIGGIPCIPVEYSISVRVVCRTGPNKTPGAAEIVVGNNAGLT
RAREQFLYKVVNLENIHPTIGPMAGGTRLYLSGENLNVGSHMEIYLDNLPCIVDRTLASN
SQVSCRTTRAPSPNYSVKMLFLIIDNATLTLPDPFIYTFNPTILRIYPLKSFVSGGRGVT
VVGTSLQAIQQPHMAIFDNETLLNETVCDVISNSQMVCPSPSLSRDAVRAFLASSKRNTG
MHAEELKFQIGFIMDDVSSVRELQANFPAIHSDMVYVPDPRFFPFHGDGIKLYKGESLVI
EGEHLLRASTESEVSVTVGTRPCNLTSLAMTQLVCLPPEDQPQGTDELGRTTVTVLPMVV
VRVGLNLRYEIGYLRYEVMKTYKFPPEAIWGIASGGALLMLFSLVILAVLRHKSSQAERE
YKRIQLQMDTLENSVRSECKQAFAELQTDMTDLTNYLQASGVPILDHKSFVMKVFFPGVY
DHPLLQDRKTKNNGLYSNYEIAMSQFQQLLNTKGFLITFINTLEGQKTFSIRDRVNVASL
LMIIFLEKMEYATEVLKTLLMQLIERSVNTKHPQLMLRRTESVVEKMLTNWMALNMYDYL
KDRAGSALFLLFCAVKYQVEKGPVDAFTHDARYSLSEERLLREQIEYSTVTIHIIQDDQD
EKLQLRVNDCDTISQVKFKVLDALYKNTPFSLRPSVNDVDLEWKSGRGGQLTLADDDLTT
KTISGWRRINTLRHYGVTESAVMSLVSRQNDSLSSNFCLTGFFITFNTGTGNTSLNSTSP
FISNCDVEHGVRYWHLVMPVDDHHGSQKDHCHKAIPEIFLTRLLSTKGTVQTFVDDFLAT
VLTVTEDIPPAVKWLFDLLDEGASKHNITDPEVAHSWKSNSLPLRFWVNFVKNPDFVLDV
YKTPLLDSCLSVVAQTLMDACSTSEHRLGKDSPSNKLLFARDIPAYRKVVMRYYKDVRVL
PAVTDQEISAKMQTLSLSHIGEFDTLAALKALYVYAAKYMDEFLQDLNDDSNCQQNHLAH
RLETVACTLQGEETSVC
Download sequence
Identical sequences XP_013786520.1.66592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]