SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013793188.1.66592 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013793188.1.66592
Domain Number 1 Region: 215-283
Classification Level Classification E-value
Superfamily Homeodomain-like 6.42e-18
Family Homeodomain 0.0000587
Further Details:      
 
Domain Number 2 Region: 72-138
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00000000000000428
Family LIM domain 0.019
Further Details:      
 
Domain Number 3 Region: 41-70
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 0.00002
Family LIM domain 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013793188.1.66592
Sequence length 419
Comment PREDICTED: insulin gene enhancer protein ISL-1-like [Limulus polyphemus]; AA=GCF_000517525.1; RF=representative genome; TAX=6850; STAX=6850; NAME=Limulus polyphemus; AL=Scaffold; RT=Major
Sequence
MRVNVRDIEGINEQHGQKQMHTYLDSTITKVNQPFFTGKQRVSTCVGCGSQINDQYILRV
APDLEWHAACLKCADCHQFLDETCTCFVRDGKTYCKRDYVRLFGAKCAKCNTGFSKDNFV
MRAKNKIYHIECFQCMACSRQLVPGDEFALRDDGLFCKADHEVLEKAINNNKGTLANGKG
NNSSANDSIGLQMAGNPANAEPMQTNRNRGSVRPQVHKQNSDIKSTRVRTVLNEKQLHTL
RTCYAANPRPDALMKEQLVEMTGLSPRVVRVWFQNKRCKDKKKSILIKQMQQQDKEGRQV
SLGTMRGVPMVASSPVRHESPLQVNPIEVQTYHPPWKTLAEYAMQPVIDPHTPHFQQLVN
QMHGYGGDPHNDPSQQVPVTTMAPPVTAMPPPYLGPGEDPLHTTHLPPTPSELSSPNSE
Download sequence
Identical sequences XP_013793188.1.66592

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]