SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013811392.1.3284 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013811392.1.3284
Domain Number 1 Region: 58-105,298-471
Classification Level Classification E-value
Superfamily YVTN repeat-like/Quinoprotein amine dehydrogenase 0.0000000494
Family YVTN repeat 0.063
Further Details:      
 
Weak hits

Sequence:  XP_013811392.1.3284
Domain Number - Region: 93-216
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 0.034
Family Extended AAA-ATPase domain 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013811392.1.3284
Sequence length 485
Comment PREDICTED: noelin isoform X1 [Apteryx australis mantelli]; AA=GCF_001039765.1; RF=representative genome; TAX=202946; STAX=8822; NAME=Apteryx australis mantelli; AL=Scaffold; RT=Major
Sequence
MSVPLLKIGVVLSTMAMITNWMSQTLPSLVGLNTTKLTAATGGTLDRSTGVLPTNPEESW
QVYSSAQDSEGRCICTVVAPQQTMCSRDARTKQLRQLLEKVQNMSQSIEVLDRRTQRDLQ
YVEKMENQMRGLESKFKQVEESHKQHLARQFKAIKAKMEELRPLIPVLEEYKADAKLVLQ
FKEEVQNLTSVLNELQEEIGAYDYEELQNRVSNLEERLRACMQKLACGKLTGISDPITIK
TSGSRFGSWMTDPLAPEGENKVWYMDSYHNNRFVREYKSMADFMNTDNFTSHRLPHPWSG
TGQVVYNGSIYFNKYQSHIIIRFDLKTETILKTRSLDYAGYNNMYHYAWGGHSDIDLMVD
ENGLWAVYATNQNAGNIVISKLDPNTLQSLQTWNTSYPKRSAGEAFIICGTLYVTNGYSG
GTKVHYAYQTNASTYEYIDIPFQNKYSHISMLDYNPKDRALYAWNNGHQILYNVTLFHVI
RSDEL
Download sequence
Identical sequences A0A1V4J5Y9 A0A218V6G4 H0Z6H8 U3JG49
NP_001185777.1.42559 XP_005055700.1.66865 XP_005493288.2.73095 XP_005529266.1.90289 XP_009567803.1.62272 XP_012433690.1.42559 XP_013811392.1.3284 XP_021399259.1.53032 ENSTGUP00000006176 ENSTGUP00000006176 ENSFALP00000001753 59729.ENSTGUP00000006176

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]