SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013865554.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013865554.1.33752
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.14e-34
Family cAMP-binding domain 0.00000094
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 6.15e-31
Family cAMP-binding domain 0.000000901
Further Details:      
 
Domain Number 3 Region: 14-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.54e-18
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013865554.1.33752
Sequence length 380
Comment PREDICTED: cAMP-dependent protein kinase type I-beta regulatory subunit [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MATSSSTLEEDESLKGCEIFVQKHNIQQILKECIVNLCIAKPERPMKFLREHFEKLEKEE
CKQIMARQKSNSQSDSHDDEVSPPPPNPVVKARRRRGGVSAEVYTEEDAVSYVRKVIPKD
YKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGE
VDVYVNGEWVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLR
KRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVVQGXPGDDFFIITEGIAS
VLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSEILKRNIQRYNSFISLTV
Download sequence
Identical sequences A0A2I4BCU8
XP_013865553.1.33752 XP_013865554.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]