SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013871381.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013871381.1.33752
Domain Number 1 Region: 32-512
Classification Level Classification E-value
Superfamily Sema domain 3.66e-97
Family Sema domain 0.00098
Further Details:      
 
Domain Number 2 Region: 1382-1507,1673-1857
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 2.43e-34
Family p120GAP domain-like 0.027
Further Details:      
 
Domain Number 3 Region: 856-947
Classification Level Classification E-value
Superfamily E set domains 0.000000000000395
Family Other IPT/TIG domains 0.012
Further Details:      
 
Domain Number 4 Region: 1039-1118
Classification Level Classification E-value
Superfamily E set domains 0.00000000000267
Family E-set domains of sugar-utilizing enzymes 0.051
Further Details:      
 
Domain Number 5 Region: 514-567
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000401
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 6 Region: 951-1027
Classification Level Classification E-value
Superfamily E set domains 0.000000000098
Family E-set domains of sugar-utilizing enzymes 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013871381.1.33752
Sequence length 1897
Comment PREDICTED: plexin-D1 [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MPPSSMEIAVLLLGVLALETRRSASALHIQQAYASPNRTNNFAVDPVSRKVYLATVNTIY
QLNGTLSVEVEKRTGPVEDNLLCHAPQLPQAPCEHPKSLTDNHNKLLKLDRDQGVVVVCG
SVYQGFCELRRMGNISEIAVEFPPQGERTVFPSMLNIAANHPNASTVGLIFKSHEGNTRL
LVGATYTGAGTQFFPKNHSKEDLRFENTPEIAIRSLNVKDLSRLFTYDINPSEDNVFKIK
QEVKTKNKLNFVHAFIQKTYSYIAFNNDAITDRKENQPSSILSRICLDTESPRKPTGPES
RKLTESYIQMPLQCGLSGNVYNRLLSVYPAEVRVPGGARGPEPYLFGVFSKADRTSALCA
FRFGDIEEEIRQGRRNCSNSPSSDVQVLDSVIQGSGAACIQKDNLVLQSEHLDCGAAHLQ
HPLAIRRPLRAVPLLEWPGLSSVAVDSVHDHTVVFLGTSNGRLRKLTLLANKTLANLTLP
ASEAVHHIMTFDPNDSNFLYVMTSHHMLRVKVAQCDQWKNCRDCLGAGDPHCGWCTLENR
CSIQKECARGLLARSWIPVGEGPQQCPSITLTPPEISISADIKDVGILINGSVPDLTGSR
VECEYRPGVSSAATLHLHGPAQIQTCPLLPRENYQPIPPGTDHMTVSVAIKVNGTPVVSG
SFIIYDCERTGAIHPKTSCTSCLSTRWKCYWDQENHLCLSNKDDSKHHLIESAASCPHLI
ASDVPPSPSGAAQDFTLSLSNIQERVKLDCDFGTEQQYEAIWLDNSTVKCTGVTLSTSQR
SQVYHLNLRRRVYFSSQRKDIFLDSPQPMKVEVYNCGVGSSDCSQCWGREDQGHLCGWCE
NSCRLRDDCQPVRDQCPAPEIYKISPLRGPTGGGTLITVQGRNLGRRPAGVQILIGDVPC
DLLPESYAVSVELVCRTGRSVHDRMEFVQVDVDQSGTGTSKEKFSYLVPKLQSIAPEKGS
RAGGTRVILTGKHLDIGSQVRVKVNNTLECNITEKTDETIECIMPPALQAHAESVVVCVE
FEDRPCDGLELSTTYTYEKNPTIVSIHPKKTFLSGGRTITVTGQGFDLVQSVTMEVLEIG
QTPCAVLSPTTITCPSPSSSQSEETSVQFILNGVIYTGDSPSSSKNEAEEENGEPQKGRF
LLEYVEDPQFFTANKEKLIKHHSGEPLTLIINKVPSDLELQLEEYSVMIGPYPCNISFHN
DQLFHCTINGLLSSSESELPVTVQVGNFHKTIARVQLGGSELAIVVSIVVCCVLLLLCTV
ALVVYCTKSRRAERYWQKTLLQMEEMESQIREEIRKGFAELQTDMTDLTKELNRSQGIPF
LEYKQFVTRTFFPKMCSDYEKSLVQPTYENDSLGPRALPETHPLLQDWQATNTTRPNVEE
GITLFSTLLNNKHFLITFVHALEQQKDFAVRDRCSLASLLTIALHGKLEYYTSIMKDLLV
DLIDASASKNPKLMLRRTESVVEKMLTNWMSICMYSYLKETVGEPFFLLLCAIKQQINKG
SIDAITGKARYTLNEEWLLRENIEAKPQNINVSFQGCGMDSLSVRVMNTDTICQVKEKII
EAFYKNLPFSQWPRAEDVDLEWFDSGSNSKLLQDLDNSSVMEDGRKKLNTVFHYQVSEGA
SLAMSMKDNKENTLKRVKDLDTEKYVHLVLPHDELIETKRSHRHSHRKKVLPEIYLTRLL
STKGTLQKFLDDLFQAILSIPLDRPPLAVKYFFDFLEEQANKRGITDPDTLHIWKTNSLP
LRFWVNILKNPQFVFDIDKTDHMDACLSVIAQAFIDACSISDLQLGKDSPTNKLLYAKEI
PEYKKRVQCYYKQIQEMAPLSEQEMNAHLAEESRKYRNEFNTNLALTEIYKYAKRYRNQV
VNALEANPTARRTQLHHKFDQVVALMEDNIYECCSEA
Download sequence
Identical sequences A0A2I4BUF2
XP_013871381.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]