SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013872617.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013872617.1.33752
Domain Number 1 Region: 122-253
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 3.01e-34
Family cAMP-binding domain 0.000000927
Further Details:      
 
Domain Number 2 Region: 257-393
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 1.7e-31
Family cAMP-binding domain 0.00000283
Further Details:      
 
Domain Number 3 Region: 2-42
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000000000275
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013872617.1.33752
Sequence length 405
Comment PREDICTED: cAMP-dependent protein kinase type II-beta regulatory subunit [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MSIEIPEGLTELLQSFTVEVLRNQPRDLLEFALQYFTQLKDSDSKEASFGNDENSAPRSG
KAVNFLDEAMQIDSENGEEDDEDDDEEFTAPVINRFIRRASVCAEAFNPDDDDEDKEPRV
THPKTDVQRQRLQEACRDILLFKNLDPEEMSQVLDAMFEKLCTEGEHIIDQDDDGDNFYV
IQSGTFNIFVKVDGMEKLVGCYDNKGSFGELALMYNTPRAATIIATSPGALWCLDRLTFR
RIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLTTRVYGDSQQIIAQGDLADCF
YIVESGQVRITMKRSRTKKDQEEEEVDIAMCTRGQYFGELALVTNKPRAASAYAVGSVKC
LVMDVKAFERLLGPCMDIMKRNIANYEEQLVTLFGSSPEIEQQSA
Download sequence
Identical sequences A0A2I4BY03
XP_013872617.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]