SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013878256.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013878256.1.33752
Domain Number 1 Region: 248-370,401-448
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 9.16e-27
Family Nucleotide and nucleoside kinases 0.00037
Further Details:      
 
Domain Number 2 Region: 59-238
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.02e-22
Family Nucleotide and nucleoside kinases 0.0016
Further Details:      
 
Domain Number 3 Region: 14-52
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00000418
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013878256.1.33752
Sequence length 451
Comment PREDICTED: adenylate kinase 8 isoform X3 [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MDETLKPVRIPPHMSIYADKHNLSHLVQSLVSSLVVDRPDDPISYLVDLLQRSRVDIPRV
MLLGPPAVGKHTLAKRLSAELKAVHVTMEGLLEDQSELRALTEQVTQDVPADLLVQLVQQ
RLKEVDCLQEGWVLEGIPQTRLQVLLLQQVGIIPDHVVMLEAPEEVLLQRAQGRLLDSLT
GAQRLERGRGLSEEQLLAELQRYRCEVTGLRSAYQHVLGVINADQPHTDVYHQALALVQT
RHYSRTPRILLLGPPGSGKSLQARLLSENYKMVNVCCGQLLRSAAADGSGPGALVQPYLD
DGRPVPDSVVLRVLEERLSRVDCSCRGWVLHGFPLNLQQARSLQETQNQPNRVFLLEAPD
HVCLERLSLRTVDPLSGERYHTVTRPAPSAEVQARLQTAPEDRLEEVTQRLNQYRVHCAA
LQSVYPDVIHINANQNHLSVFEALESRLTTN
Download sequence
Identical sequences A0A2I4CE36
XP_013878256.1.33752

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]