SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013879492.1.33752 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013879492.1.33752
Domain Number 1 Region: 118-239
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 9.03e-35
Family cAMP-binding domain 0.000000516
Further Details:      
 
Domain Number 2 Region: 247-371
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 7.46e-33
Family cAMP-binding domain 0.000000529
Further Details:      
 
Domain Number 3 Region: 13-61
Classification Level Classification E-value
Superfamily Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 1.7e-20
Family Dimerization-anchoring domain of cAMP-dependent PK regulatory subunit 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013879492.1.33752
Sequence length 380
Comment PREDICTED: cAMP-dependent protein kinase type I-alpha regulatory subunit [Austrofundulus limnaeus]; AA=GCF_001266775.1; RF=representative genome; TAX=52670; STAX=52670; NAME=Austrofundulus limnaeus; strain=Quisiro; AL=Scaffold; RT=Major
Sequence
MASGSTSSEEERSLRECEQYVQKHNIQQLLKDCIVQLCTSRPDRPMAFLREYFERLEKEE
AKQIQSQQKASSSRSDSRDEEVSPPMNPVVKGRRRRGAFSAEVYTEEDAASYVRKVIPKD
YKTMAALAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGETVIQQGDEGDNFYVIDQGE
MDVYVNNEWVTSIGEGGSFGELALIYGTPRAATVRAKTNVKLWGIDRDSYRRILMGSTLR
KRKMYEEFLRKVSILESLDKWERLTVADALEPVQFEDGQKIVVQGEPGDEFFIILEGSAA
VLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVARGPLKCVKLDRPRFERVLGP
CSDILKRNIQQYNSFVSLSV
Download sequence
Identical sequences A0A1A7Z6A5 A0A1A8EZ73 A0A2I4CHN4
XP_008436018.1.1237 XP_013879492.1.33752 XP_013879493.1.33752 XP_017166449.1.1237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]