SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013906403.1.7768 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013906403.1.7768
Domain Number 1 Region: 234-306
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 4.53e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0013
Further Details:      
 
Domain Number 2 Region: 321-396
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000128
Family Eukaryotic type KH-domain (KH-domain type I) 0.0026
Further Details:      
 
Domain Number 3 Region: 141-222
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000000000000219
Family Eukaryotic type KH-domain (KH-domain type I) 0.002
Further Details:      
 
Domain Number 4 Region: 508-537
Classification Level Classification E-value
Superfamily WW domain 0.00000000608
Family WW domain 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013906403.1.7768
Sequence length 538
Comment Far upstream element-binding protein 3 [Monoraphidium neglectum]; AA=GCF_000611645.1; RF=representative genome; TAX=145388; STAX=145388; NAME=Monoraphidium neglectum; strain=SAG 48.87; AL=Scaffold; RT=Major
Sequence
MAEDAAAPVSDLEQQEEQQQEAVPEQAEEAGLKKRERGDDEDEQEPTAKRPNHNAEDEED
PPAADELPAATAEAAQQDAPVEAAADGGDCPDNAGGAAADPPAEGAAPAAAADEAAAGNP
GPAGGNPGTGAGVPAGHSPDDREYTVHPDGTVSEVLHIAKTMIGKLIGKAGATIMGLQAS
TGASIQVDQATATRGGECRRVTIKGTAAQVESAKAQVEAVLAADAPGAAPASGETSTDVR
CPQAVVGRIIGRAGETIKLLQAASGAYILVNQNFPDGEDRIVTVSGSNDSVERAANMIRD
LIASDQNTVQSVIQKYGHGKTIKLQCPRSAVGRIIGRGGETVKMLQRKYNASVQINQSTD
PMDITIIASPHEAEACQAEINHIIMHPDMPMGGGGGMGPGFRGGPGGGGMGPRPGYGGGG
MPGPYGMGMPGMYGAMPYGGMMPPYGGYGMGMPPAAMPAYGGYAMGGGYDAAAYGGAGGY
GGGAAVGAQQQYGGPAGGVGAGGAAASVWQAIPDDQGRTYYYNSQTGVSQWEKPADMP
Download sequence
Identical sequences A0A0D2LM01
XP_013906403.1.7768

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]