SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013914181.1.67126 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013914181.1.67126
Domain Number 1 Region: 418-583
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 1.31e-69
Family A middle domain of Talin 1 0.000000373
Further Details:      
 
Domain Number 2 Region: 683-818
Classification Level Classification E-value
Superfamily I/LWEQ domain 6.08e-54
Family I/LWEQ domain 0.00000186
Further Details:      
 
Domain Number 3 Region: 589-712
Classification Level Classification E-value
Superfamily I/LWEQ domain 9.03e-52
Family I/LWEQ domain 0.00000478
Further Details:      
 
Domain Number 4 Region: 1149-1339
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.85e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 5 Region: 124-238
Classification Level Classification E-value
Superfamily Second domain of FERM 1.27e-32
Family Second domain of FERM 0.00000147
Further Details:      
 
Domain Number 6 Region: 239-329
Classification Level Classification E-value
Superfamily PH domain-like 1.03e-24
Family Third domain of FERM 0.0000172
Further Details:      
 
Domain Number 7 Region: 8-61
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000126
Family Ubiquitin-related 0.062
Further Details:      
 
Domain Number 8 Region: 873-972
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.00000863
Family I/LWEQ domain 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013914181.1.67126
Sequence length 1395
Comment PREDICTED: talin-2 [Thamnophis sirtalis]; AA=GCF_001077635.1; RF=representative genome; TAX=35019; STAX=35019; NAME=Thamnophis sirtalis; AL=Scaffold; RT=Major
Sequence
MLRNGDVLEYKKKQRPQKIRMLDGSVKTVMVDDSKTVGELLVTICSRIGITNYEEYSLIQ
EGIEEKKEEGTGTLKKDRTLLRDEKKMEKLKAKLHTDDDLNWLDHSRTFREQGVDENETL
LLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFEKACEFGAFQAQIQFGPHV
EHKHKPGFLDLKEFLPKEYIKQRGAEKRIFQEHKNCGEMTEIEAKVKYVKLARSLRTYGV
SFFLVKEKMKGKNKLVPRLLGITKESVMRVDEKTKEVLQEWPLTTVKRWAASPKSFTLDF
GEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEESTMLEESISPKKST
ILQQQFNRTGKVEHGSVALPAVMRSGSTGPETFNMGSMPSPQQQVTVGQMHRAHMPPLTS
AQQALMGTITTSMQAVQQTQADLTHVDDLPPLGNDMASRVWVQNKVDESKHEIHSQVDAI
TAGTASVVNLTAGDPVDTDYTAVGCAITTISSNLTEMSKGVKLLAALMDDEVGSGEDLLK
AARTLAGAVSNLLKAVEPTSGEPRQTVLTAAGSIGQASGELLRQIGENEADERFQDVLMS
LAKAVANAAAMLVLKAKNVAQVAEDTVLQNRVIAAATQCALSTSQLVACAKVVSPTISSP
VCQEQLIEAGKLVDRSVENCVRACQAATDDTELLKQVSAAASVVSQALNDLLQHVRQFAS
RGEPIGRYDQATDTIMYVTESIFSSMGDAGEMVRQARVLAQATSDLVNAMRSDAEAEIDM
ENSKKLLAAAKLLADSTARMVEAAKGAAANPDNEDQQQRLREAAEGLRVATNAAAQNAIK
KKIVNRLEVAAKQAAAAATQTIAASQNAAISNKNSAAHQQLVQSCKNVADHIPQLVQGVR
GSQAQAEDLGAQLTLINSSQSFLQPGSKMVASAKAAVPTVSDQAAAMQLSQCAKNLATSL
AELRTASQKAHEACGPMEIDSALNTVQTLKNELQDAKMAALDGQLKPLPGETVFQSRDVP
EKTCSPEESIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRKAVADMLAACKQASYHP
DVSEEVRLRALHYGTECTLAYLQLLEHVLMILQKPSAELKHPLTALSKGVAGAVTELIQS
AEAMKGTEWVNPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETLDFEEQIL
EAAKSIAAATSALVKSASAAQRELVAQGKVGAIPANAVDDGQWSQGLISAARMVAAATSN
LCEAANASVQGHASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQVAGNAVKRA
SDNLVRAAQKAAFGKADDDDVVVKTKFVGGIAQIIAAQEEMLKKERELEEARKKLAQIRQ
QQYKFLPSELREEEG
Download sequence
Identical sequences XP_013914181.1.67126

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]