SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013949405.1.71794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013949405.1.71794
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily EF-hand 1e-55
Family Calmodulin-like 0.00000188
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013949405.1.71794
Sequence length 149
Comment regulatory protein calmodulin [Trichoderma virens Gv29-8]; AA=GCF_000170995.1; RF=representative genome; TAX=413071; STAX=29875; NAME=Trichoderma virens Gv29-8; strain=Gv29-8; AL=Scaffold; RT=Major
Sequence
MADSLTEEQVSEFKEAFSLFDKDGDGQITTKELGTVMRSLGQNPSESELQDMINEVDADN
NGSIDFPEFLTMMARKMKDTDSEEEIREAFKVFDRDNNGFISAAELRHVMTSIGEKLTDD
EVDEMIREADQDGDGRIDYNEFVQLMMQK
Download sequence
Identical sequences A0A024S2B6 A0A0F9X1Z0 A0A1T3CVM4 A0A2H2ZY92 G0RR49 G9NDR1 G9NIW3
jgi|Trive1|111915|estExt_fgenesh2_kg.C_280010 jgi|Triha1|498316|fgenesh1_pm.12_#_43 jgi|Trias1|62411|fgenesh1_kg.17_#_148_#_Locus175v1rpkm677.16 jgi|Trici1|22811|fgenesh1_pg.13_#_281 jgi|Trilo1|160140|CE91042_94530 XP_006967657.1.9351 XP_013947876.1.20613 XP_013949405.1.71794 51453.JGI80447 jgi|Triat1|146638|estExt_fgenesh1_kg.C_130016 jgi|Trire2|80447|estExt_GeneWisePlus.C_180262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]