SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013959334.1.71794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013959334.1.71794
Domain Number 1 Region: 6-74
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.13e-19
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013959334.1.71794
Sequence length 83
Comment hypothetical protein TRIVIDRAFT_32934 [Trichoderma virens Gv29-8]; AA=GCF_000170995.1; RF=representative genome; TAX=413071; STAX=29875; NAME=Trichoderma virens Gv29-8; strain=Gv29-8; AL=Scaffold; RT=Major
Sequence
MAPAQPELKKYLDKRLFVQLNGSRKVIGVLRGYDVFLNIVLDEAVEEKDGGEKIRLGMVV
IRGNSVVMLEALERIGGDDRQNR
Download sequence
Identical sequences A0A024RW81 A0A0F9WU04 A0A1T3CTT0 G0REQ9 G9MKE5
jgi|Trilo1|7131|gm1.7131_g XP_006963552.1.9351 XP_013959334.1.71794 jgi|Trive1|32934|e_gw1.3.1916.1 jgi|Trire2|21972|estExt_fgenesh1_pm.C_50210 51453.JGI21972 jgi|Triha1|439995|CE270146_10305

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]