SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013960241.1.71794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013960241.1.71794
Domain Number 1 Region: 8-110
Classification Level Classification E-value
Superfamily Sm-like ribonucleoproteins 1.31e-24
Family Sm motif of small nuclear ribonucleoproteins, SNRNP 0.00032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013960241.1.71794
Sequence length 114
Comment hypothetical protein TRIVIDRAFT_27430, partial [Trichoderma virens Gv29-8]; AA=GCF_000170995.1; RF=representative genome; TAX=413071; STAX=29875; NAME=Trichoderma virens Gv29-8; strain=Gv29-8; AL=Scaffold; RT=Major
Sequence
MTSTIGIPIKLLNEAQGHIITLEITSGQTYRGKLLEAEDNMNVQLKDITVTARDGRVSHL
DQVYIRGSHVRFFIVPDMLRNAPMFRSRNVRGRGVGLARGRATVSRARASGGRG
Download sequence
Identical sequences A0A024SET5 G0RGL5 G9MH34 G9P946
jgi|Trire2|34079|gw1.7.504.1 jgi|Triat1|134655|estExt_Genewise1.C_11021 jgi|Trilo1|40575|gw1.4.1454.1 jgi|Trias1|99569|gw1.5.379.1 jgi|Trici1|38110|gw1.2.1389.1 jgi|Trive1|27430|gw1.5.1378.1 XP_006964416.1.9351 XP_013940119.1.20613 XP_013960241.1.71794 51453.JGI34079 jgi|Triha1|60465|gw1.3.2231.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]