SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013960512.1.71794 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013960512.1.71794
Domain Number 1 Region: 42-129
Classification Level Classification E-value
Superfamily HMG-box 0.000000000000445
Family HMG-box 0.0019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013960512.1.71794
Sequence length 202
Comment hypothetical protein TRIVIDRAFT_35357 [Trichoderma virens Gv29-8]; AA=GCF_000170995.1; RF=representative genome; TAX=413071; STAX=29875; NAME=Trichoderma virens Gv29-8; strain=Gv29-8; AL=Scaffold; RT=Major
Sequence
MSPQISLPLLGEGTAEGPQGDLLNTFDATGQLIMPMPGITPIVEEKKERKKRTYDPNAPK
RPLTAFFLYMQHARSIIAIDLGADAPKGAIQVEGELRWAYMDPREKLGWSSAYQFNLRLY
NARVHSYKNRNFDAKNMPDGEAFMYAKDFHIPMPELKEIATQAKVPVNDKETIVELLQQV
TAAACDGDEEEIMNSVYDIALG
Download sequence
Identical sequences G9MHW3
XP_013960512.1.71794 jgi|Trive1|35357|e_gw1.5.1269.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]