SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013965538.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013965538.1.84170
Domain Number 1 Region: 2-142
Classification Level Classification E-value
Superfamily Cyclin-like 6.01e-25
Family Cyclin 0.0031
Further Details:      
 
Domain Number 2 Region: 145-252
Classification Level Classification E-value
Superfamily Cyclin-like 8.51e-20
Family Cyclin 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013965538.1.84170
Sequence length 390
Comment PREDICTED: cyclin-J-like protein [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MDEPWWEGRVASDVHCTLREKELKLPAFRAHSLLLKSRRFFVDILTLLSSHCQLCPAARH
LAVYLLDHFLDRYNITTSKQLYAVAVSCLLLASKFEDREDHVPKLEQINSTRILSGQNFT
LTKKELLNTELLLLEAFGWNLCLPTPAHFLDYYLLASVSQKDHHCHSWPTACPRKTKECL
KEYAHYFLEVTLRDHIFYKFQPSVVAAACVGASRICLQLSPYWTRDLQRISNYSLEHLST
CIEILLVAYDNVFKDAVAVKSQSLTMVPSRSPAPTQVLFQPPTYPTLSQPATTPALAQFQ
TQTPVQDLCLAYRDSLQAHRSGSLLSGGSGLSLHTLYPTLQPLDVCPMSLPAPLSVQMAI
TAEPRHCLATAYGSSYFSGSHAFPTGCFDR
Download sequence
Identical sequences J9NT44
ENSCAFP00000042757 XP_013965538.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]