SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013967159.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013967159.1.84170
Domain Number 1 Region: 90-515
Classification Level Classification E-value
Superfamily Sema domain 6.28e-98
Family Sema domain 0.00039
Further Details:      
 
Domain Number 2 Region: 1405-1531,1730-1881
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 5.1e-41
Family p120GAP domain-like 0.038
Further Details:      
 
Domain Number 3 Region: 959-1048
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000191
Family Other IPT/TIG domains 0.056
Further Details:      
 
Domain Number 4 Region: 867-962
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000369
Family Other IPT/TIG domains 0.027
Further Details:      
 
Domain Number 5 Region: 518-570
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000173
Family Plexin repeat 0.0024
Further Details:      
 
Domain Number 6 Region: 1047-1091,1129-1182
Classification Level Classification E-value
Superfamily E set domains 0.000000056
Family Quinohemoprotein amine dehydrogenase A chain, domains 4 and 5 0.078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013967159.1.84170
Sequence length 1949
Comment PREDICTED: plexin-B3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MRLPWCHTAWETPPLLPCEAHLWLLPCLSHRPSVRGSPSVRVLRLSGICPSSNHLDAEKV
PAMAPRPPLGPHLLLALLLSLPPPPTRARHFSAPNATFNHLALAPGLGTLYVGAVNRLFQ
LSPELRLQAVAVTGPVLDSPDCVPFRDPADCPHARLTDNANQLLLVSGRARELVACGQVR
QGVCDKRRLDDVAHVLYQAEDPGDGQFVAANAPGVATVGLVVQAPDRDLLLVARGLAGKL
SAGVPPLTVRQLAGPQPFSSEGLGRLVVGDLSDYNNSYVGAFAAGRSAYFVFRRRGARAQ
ADYRSYAARVCLGDANLYSYVEVPLACRGQGLIQAAAVTPSTLLGAFAAGPNGAGAALCA
FPLARLDASMEHARRLCYTAGGRSPGGAEEATVEYGVTSRCAALPADSPESYPCGDEHTP
SPIAGRQPLEAEPLLQLEQPVSAVAGLQADGHTIAFLGDTQGQLHKVFLNGSHGHVYHSQ
QVGPRGSAISPDLLVDGNGSHVYVLTAQQVDRVPVAACPEFPDCTSCLQAQDPLCGWCVL
QGRCTLKGQCGRAAQANQWLWSYEDSHCPHVQSLLPAYRPRQEQGQVTLSVPRLPTLAAD
EYFHCAFGDYDSLAHVEGPHVACVTPPQDQLPLNPPGTDHITLPLALMFEDVAVAATNFS
FYDCSAVQALEVAAPCRACVGSIWRCHWCPRSSRCVYGEHCPEGEGTIYSAQEADVQVRG
PGACPRVEGLAGPVLLPVGWKSRLALRVRNLQHFGVPASYHCWLELPGXXRGVPSRARPD
PTLHPQLRPSVAQRELRVPIYVTRGKAQRLDNAHTLHVTLYDCAVGHPDCSRCQAANGSL
GCVWCSHRQPACRYGPLCPPEAVELLCPSPRIDRIEPLTGPPEGGLALTIWGSNLGRDFA
EVQDAVNVAGRPCSPEPSLYRTSARIVCVTSPAPNGTTGPIQVAIKNRPPGISTQHFTYQ
DPILLSLSPQWGPQAGGTQLTIHGQHLQTGGNISAFVGAQPCPIQEPVCPEAIVCHTMSQ
ASPGEAVVRVVFGHAQRTLLTSPFQYTANPQLVAAEPSVSFRGGGRLIRVRGTGLDVVQQ
PLLSVWLAATAEVQAAGAEPRDPTPRTSCGGPAAAPQACIPLREGLLQCSTVCSINSSSL
LLCQSPAVPDGVHPQRVFFTLDNVHVDFASANGGQDFQYQPNPRLAPLSREEPTRPYRLK
PGNVLDVEGQGLNLGISKEEVRVHIGDGECLVKTLTLTHLYCEPPSRAPQPANGSSALPQ
FVVQMGNVRLALGPVQYETEPTLSAFPVEAQVGLGLGAAVLIAAVLLLTLMYRHKSKQAL
RDYQKVLVQLENLEIGVGDQCRKEFTDLMTEMTDLSSDLEASGIPFLDYHTYAERVFFPG
HGGCPLQPALEGPGEEGRRAPVRQGLTQLSNLLNSKLFLLTLIHTLEEQPSFSQRDRCHV
ASLLSLALHGKLEYLTDILRTLLSDLAAHYVHKNPKLMLRRTETMVEKLLTNWLSICLYA
FLKEVAGEPLYMLLRAIQYQVDKGPVDAVTGKAKRTLNDSRLLREDVEFRPLTLMVLAGP
RAGGAAGGGAVQRVPARVLDTDTITQVKEKVLEQVYKGTPFSQRPSAHALDLEWRSGLAG
HLTLSDEDLTSVTQNHWKRLNTLQHYKVPDGATVGLIPQLHNGGAVSQSLAQNCTLGENV
PMLEDGEEGGVHLWHLVKGTEEPEGAKARRSSLRERERERERARAKAIPEIYLTRLLSMK
GTLQKFVDDTFQAILSVNRPVPIAIKYLFDFLDELAEKHGIEDPETLHIWKTNSLLLRFW
VNALKNPQLIFDVRVSDNVDAILAVIAQTFIDSCTVSEHKVGRDSPVNKLLYAREIPRYK
QMVERYYSDIRQSSPASYQEMNSALAELSGNYTSAPHCLEALQELYNHIHRYYDQIISAL
EEDPVGQKMQLACRLQQVAALVENKVTDL
Download sequence
Identical sequences XP_013967159.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]