SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013967890.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013967890.1.84170
Domain Number 1 Region: 180-341
Classification Level Classification E-value
Superfamily CRAL/TRIO domain 2.35e-47
Family CRAL/TRIO domain 0.0000732
Further Details:      
 
Domain Number 2 Region: 85-169
Classification Level Classification E-value
Superfamily CRAL/TRIO N-terminal domain 0.00000000000000262
Family CRAL/TRIO N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013967890.1.84170
Sequence length 357
Comment PREDICTED: retinaldehyde-binding protein 1 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MISRGPSTFLQPSLGGGCLERPGRKRGPSFSEDSESPRGSMSEGVGTFRVVPEEEQELRA
QLERLTTKDHGPVFGPCSQLPRHTLQKAKDELNEREETREEVVRELQELVQAQAATGQEL
ARAVAERVQGRDSAFFLRFIRARKFHVGRAYELLRGYVNFRLQYPELFDSLSLEAVRCTV
EAGYPGVLPSRDKYGRVVMLFNIENWDSEEITFDEILQAYCFILEKLLENEETQINGFCI
IENFKGFTMQQAAGLRASDLRKMVDMLQDSFPARFKAIHFIHQPWYFTTTYNMVKPLLKN
KLLQRVFVHGDDLSGFFQEIDEDILPADFGGTLPKYDGKVVAEQLFGPRAQAENTAF
Download sequence
Identical sequences E2R7K7
ENSCAFP00000017037 ENSCAFP00000017037 XP_005618409.1.84170 XP_013967890.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]