SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013969692.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013969692.1.84170
Domain Number 1 Region: 40-147
Classification Level Classification E-value
Superfamily ArfGap/RecO-like zinc finger 2.09e-27
Family Pyk2-associated protein beta ARF-GAP domain 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013969692.1.84170
Sequence length 491
Comment PREDICTED: arf-GAP domain and FG repeat-containing protein 2 isoform X3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MVMAAKKGPGPGGGVSGGKAEAEAASEVWCRRVRELGGCSQAGNRHCFECAQRGVTYVDI
TVGSFVCTTCSGLLRGLNPPHRVKSISMTTFTEPEVVFLQSRGNEVCRKIWLGLFDARTS
LIPDSRDPQKVKEFLQEKYEKKRWYVPPDQVKGPAYTKGSASTPIQGSIPEGKPLRTLLG
DPVPSLSAAASASSQSICQSQPRTSQPRSSQPPPHSSIKKASTDLLADIGGDPFAAPQVA
PAFAAFPAFGGQTPSHGGFANFDAFGSSPGSSAFGSIPPAGQGPFQAQPTATASRMLTGS
YSFGSSQVTPFGASPLAPTSQPNSLPDMGSLLGPGVSAGGIPSSVFGVAGQVPALQSAPA
GGGGGSTGLAFGAFTNPFTVPATHPQLPSTNPFQPNGLATGSSFGMSSTGPGFPQTVPPT
RAFVSTFPPPVFPPQTSMTQQQNGSSFSDLGSAKLGQRQLSQPAGTSTNPFMTGSSSSPF
ASRPPTTNPFL
Download sequence
Identical sequences J9NUD1
ENSCAFP00000021184 XP_013969692.1.84170 ENSCAFP00000036769

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]