SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013971517.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013971517.1.84170
Domain Number 1 Region: 4-170
Classification Level Classification E-value
Superfamily PH domain-like 4.24e-44
Family Phosphotyrosine-binding domain (PTB) 0.000000148
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013971517.1.84170
Sequence length 609
Comment PREDICTED: protein numb homolog isoform X4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MNKLRQSFRRKKDVYVPEASRPHQWQTDEEGVRTGKCSFPVKYLGHVEVDESRGMHICED
AVKRLKAERKFFKGFFGKTGKKAVKAVLWVSADGLRVVDEKTKDLIVDQTIEKVSFCAPD
RNFDRAFSYICRDGTTRRWICHCFMAVKDTGERLSHAVGCAFAACLERKQKREKECGVTA
TFDASRTTFTREGSFRVTTATEQAEREEIMKQIQDAKKAETDKTVVGSSVAPGNTAPSPS
SPTSPTLDATASLETNNPHAIPRRHAPIEQLARQGSFRGFPALSQKMSPFKRQLSLRINE
LPSTMQRKTDFPIKNAVPEVEGEAESISSLCSQITNAFSTPSEDPFSSAPMTKPVTVIAP
QSPAFQGTEWGQSSGAASPGLFQAGHRRTPSEADRWLEEVSKSVRAQQPQASSVPLQPVL
QPPPPTAITQPAPPFQGNAFLTSQPVPVGVVPPLQPAFVPTQSYPVANGLPYPAPNVPVV
GITPSQMVANVFGTAGHPQASQPQAAHPHQSPSLVKQQTFPQYETGSATASPFFKPPAQH
LNGSAAFNGVDDGRLASGDKHTEVPAGTFPVDPFEAQWAALESKSKQRTNPSPTNPFSSD
LQKTFEIEL
Download sequence
Identical sequences F6UX21
ENSCAFP00000024756 XP_013971517.1.84170 ENSCAFP00000024756

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]