SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013971972.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013971972.1.84170
Domain Number 1 Region: 38-79
Classification Level Classification E-value
Superfamily F-box domain 0.00000379
Family F-box domain 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013971972.1.84170
Sequence length 452
Comment PREDICTED: F-box only protein 47 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MASRINTGFTLIPNQKYRRSNRRSTSYFSNTLGSDSQPLSTLGNFKALPLEIFQIILRYL
SVKDISMLSMVSKTVSQHIINYISTSSGSKRLLLQDFHNLELPSKRQDSIILEYYRSLGL
LFKRCTLLLPTKERLKYIHKILAEVSCFKFNGCAAPIQCLGLPCYGMFLQTLTAGWDELE
CHRVYNFLCELTNLSRKMQTAVCSKPGSARKLELRIRLFCRNVLLDHWTHQSDSAFWLTR
ILKPWPMVNQARLLYIIFGPVSPQDGQVVWQKMIEGPTDESSLKDLADAIKLLYDTGTKE
WTADDVISLVDELSVVPREWLLENNARLLILSGNNICFTFMASKAVNGRAIELAKLIVFL
ALVCEKELYCMDWAVKMMQKVCKVFSTPVERNNFLQSVANAFACVIMEMLQSVMSGDRDE
DDRSFLNLFHLVHAQANFHKEVLYLTMNTLST
Download sequence
Identical sequences E2RNY5
XP_013971972.1.84170 ENSCAFP00000033725 ENSCAFP00000033725

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]