SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013972303.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013972303.1.84170
Domain Number 1 Region: 643-813
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1e-52
Family BCR-homology GTPase activation domain (BH-domain) 0.0000714
Further Details:      
 
Domain Number 2 Region: 68-283
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 1.19e-43
Family DBL homology domain (DH-domain) 0.0004
Further Details:      
 
Domain Number 3 Region: 299-368,426-460
Classification Level Classification E-value
Superfamily PH domain-like 5.73e-20
Family Pleckstrin-homology domain (PH domain) 0.025
Further Details:      
 
Domain Number 4 Region: 503-609
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 0.000000000000136
Family Synaptotagmin-like (S variant) 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013972303.1.84170
Sequence length 859
Comment PREDICTED: active breakpoint cluster region-related protein isoform X4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MEPLSHRGLPRLSWIDTLYSNFSYGADDYDGEGNEEQKGPPEGSETMPYIDESPTMSPQL
SARGQGGGDSTSPTPPEGLAPGVEAGKGLEMRKLVLSGFLASEEIYINQLEALLLPMKPL
KATATTSQPVLTIQQIETIFYKIQDIYEIHKEFYDNLCPKVQQWDSQVTMGHLFQKLASQ
LGVYKAFVDNYKVALETAEKCSQSNNQFQKISEELKVKGPKDSKDSHTSVTMEALLYKPI
DRVTRSTLVLHDLLKHTPVDHPDYPLLQDALRISQNFLSSINEDIDPRRTAVTTPKGETR
QLVKDGFLVEVSESSRKLRHVFLFTDVLLCAKLKKTSAGKHQQYDCKWYIPLADLVFPSP
EESEASPQVHPFPDHELEDMKMKISALKSEIQKEKANKGQSRAIERLKKKMFENEFLLLL
NSPTIPFRIHNRNGKSYLFLLSSDYERSEWREAIQKLQKKDLQAFVLSSVELQVLTGSCF
KLRTVHNIPVTSNKDDDESPGLYGFLHVIVHSAKGFKQSANLYCTLEVDSFGYFVSKAKT
RVFRDTTEPKWDEEFEIELEGSQSLRILCYEKCYDKTKVNKDNNEIVDKIMGKGQIQLDP
QTVETKNWHTDVIEMNGIKVEFSMKFTSRDMSLKRTPSKKQTGVFGVKISVVTKRERSKV
PYIVRQCVEEVEKRGIEEVGIYRISGVATDIQALKAVFDANNKDILLMLSDMDINAIAGT
LKLYFRELPEPLLTDRLYPAFMEGIALSDPAAKENCMMHLLRTLPDPNLITFLFLLEHLK
RVAEKEPVNKMSLHNLATVFGPTLLRPSEVESKAHLTSAADIWSHDVMAQVQVLLYYLQH
PPISFAELKRNTLYFSTDV
Download sequence
Identical sequences F6XYC2
XP_013972303.1.84170 ENSCAFP00000028129 ENSCAFP00000028129

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]