SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013974455.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013974455.1.84170
Domain Number 1 Region: 40-506
Classification Level Classification E-value
Superfamily Sema domain 1.96e-131
Family Sema domain 0.0000174
Further Details:      
 
Domain Number 2 Region: 1351-1478,1674-1863
Classification Level Classification E-value
Superfamily GTPase activation domain, GAP 1.88e-51
Family p120GAP domain-like 0.024
Further Details:      
 
Domain Number 3 Region: 951-1038
Classification Level Classification E-value
Superfamily E set domains 1.98e-16
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.053
Further Details:      
 
Domain Number 4 Region: 857-951
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000026
Family Other IPT/TIG domains 0.006
Further Details:      
 
Domain Number 5 Region: 1036-1140
Classification Level Classification E-value
Superfamily E set domains 0.0000000000000216
Family NF-kappa-B/REL/DORSAL transcription factors, C-terminal domain 0.055
Further Details:      
 
Domain Number 6 Region: 509-561
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000000000000798
Family Plexin repeat 0.0013
Further Details:      
 
Domain Number 7 Region: 1137-1226
Classification Level Classification E-value
Superfamily E set domains 0.0000014
Family E-set domains of sugar-utilizing enzymes 0.084
Further Details:      
 
Domain Number 8 Region: 808-840
Classification Level Classification E-value
Superfamily Plexin repeat 0.0000419
Family Plexin repeat 0.0025
Further Details:      
 
Weak hits

Sequence:  XP_013974455.1.84170
Domain Number - Region: 653-685
Classification Level Classification E-value
Superfamily Plexin repeat 0.0523
Family Plexin repeat 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013974455.1.84170
Sequence length 1893
Comment PREDICTED: plexin-A4 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MKAMPWNWTCFLSHLLMVGMGSSTLLPRQPAPLSQKRSFVTFRGEPAEGFNHLVVDERTG
HIYLGAVNRIYKLSSDLKVLVTHQTGPDEDNPKCYPPRIVQTCNEPLTTTNNVNKMLLID
YKENRLIACGSLYQGICKLLRLEDLFKLGEPFHKKEHYLSGVNESGSVFGVIVSYSNLDD
KLFIATAVDGKPEYFPTISSRRLTKNSEADGMFAYVFHDEFVASMIKIPSDTFTVIPDFD
IYYVYGFSSGNFVYFLTLQPEMVSPPGSTTKEQVYTSKLVRLCKEDTAFNSYVEVPIGCE
RSGVEYRLLQAAYLSKAGAVLAQTLGVRPEDDLLFTVFSKGQKRKMKSLDESALCIFILK
QINDRIKERLQSCYRGEGTLDLAWLKVKDIPCSSALLTIDDNFCGLDMNAPLGVSEMVRG
IPVFTEDRDRMTSVIAYVYKNHSLAFVGTKSGKLKKIRVDGPRGNALQYETVQVVDPGPV
LRDMAFSKDHEQLYIMSERQLTRVPVESCSQYRSCSECLGSGDPHCGWCVLHNTCTRKER
CERSREPRRFASEMKQCVRLTVHPSNISVSQYNVLLVLETYNVPELSAGVNCTFEDLSEM
DGLVVGNQIQCYSPAAKEVPRIITENGDHHVVQLQLKSKETGMTFASTSFVFYNCSVHNS
CLSCVESPYRCHWCKYRHVCTHDPKTCSFQEGRVKVPEDCPQLLRVDKILVPVEVIKPIT
LKAKNLPQPQSGQRGYECVLSIQGNEQRVPALRFNSSSVQCQNTSYSYEGMEINNLPVEL
TVVWNGHFNIDNPAQNKVHLYKCGAMRESCGLCLKADPDFQCGWCQSQGQCTLRQHCPVH
ESQWLELSGANSRCTNPRITEIIPVTGPREGGTKVTIRGENLGLEFRDIASHVKVAGVEC
SPLVDGYIPAEQIVCEMGEAKPSQHAGFVEICVAVCRPEFMARSSQLYYFMTLTLSDLKP
KRGPMSGGTQVTITGTNLNAGSNVVVMFGKQPCLFHRRSPSYIICNTTSSDEVLEMKVMV
QVDKASIHQDLFFQYVEDPTIVRIEPEWSIVSGNTPIAVWGTHLDLIQNPQIRAKHGGKE
HINLCEVLNATEMTCQAPALALGPDHQSDLTERPEEFGFILDNVQSLLILNKTNFTYYPN
PVFEAFGPSGILELKPGTPIILKGKNLIPPVAGGNVKLNYTVLVGEKPCTVTVSDVQLLC
ESPNLIGRHKVMARVGGMEYSPGMVYVAPDSPLSLPAIVSIAVAGGLLVIFIVAVLIAYK
RKSRESDLTLKRLQMQMDNLESRVALECKEAFAELQTDIHELTSDLDGAGIPFLDYRTYT
MRVLFPGIEDHPVLRDLEVPGYRQERVEKGLKLFAQLINNKVFLLSFIRTLESQRSFSMR
DRGNVASLIMTVLQSKLEYATDVLKQLLADLIDKNLESKNHPKLLLRRTESVAEKMLTNW
FTFLLYKFLKECAGEPLFSLFCAIKQQMEKGPIDAITGEARYSLSEDKLIRQQIDYKTLV
LSCVNPDNANSPEVPVKILNCDTITQVKEKILDAIFKNVPCSHRPKAADMDLEWRQGSGA
RMILQDEDITTKIENDWKRLNTLAHYQVPDGSVVALVSKQVTAYNAVNNSTVSRTSASKY
ENMIRYTGSPDSLRSRTPMITPDLESGVKMWHLVKNHEHGDQKEGDRGSKMVSEIYLTRL
LATKGTLQKFVDDLFETIFSTAHRGSALPLAIKYMFDFLDEQADKHGIHDPHVRHTWKSN
CLPLRFWVNMIKNPQFVFDIHKNSITDACLSVVAQTFMDSCSTSEHRLGKDSPSNKLLYA
KDIPSYKNWVERYYSDIGKMPAISDQDMNAYLAEQSRMHMNEFNAMSALSEIFSYVGKYS
EEILGPLDHDDQCGKQKLAYKLEQVITLMSLDS
Download sequence
Identical sequences E2RL41
ENSCAFP00000001969 ENSCAFP00000001969 XP_013974455.1.84170 XP_539370.2.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]