SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013975332.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013975332.1.84170
Domain Number 1 Region: 1296-1436
Classification Level Classification E-value
Superfamily PH domain-like 4.92e-53
Family Phosphotyrosine-binding domain (PTB) 0.00000189
Further Details:      
 
Domain Number 2 Region: 173-301
Classification Level Classification E-value
Superfamily C2 domain (Calcium/lipid-binding domain, CaLB) 2.98e-37
Family PLC-like (P variant) 0.0017
Further Details:      
 
Domain Number 3 Region: 7-169
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 1.9e-29
Family Dual specificity phosphatase-like 0.00016
Further Details:      
 
Domain Number 4 Region: 1162-1283
Classification Level Classification E-value
Superfamily SH2 domain 1.05e-23
Family SH2 domain 0.0015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013975332.1.84170
Sequence length 1442
Comment PREDICTED: tensin-3 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MEDGRELDLTYITERIIAVSFPAGCSEESYLHNLQEVTRMLRSKHGDNYLVLNLSEKRYD
LTKLNPKILDVGWPELHAPPLDQVCTICKAQESWLNSDPQHVVVIHCRGGKGRIGVVISS
YMHFTNVSASADQALDRFAMKKFYDDKVSDLMQPSQKRYVQFLSGLLSGTVKMNASPLFL
HFVILHGTPNFDAGGACRPFLKLYQAMQPVYTSGIYNIGPETQSRIPIAIEPAQLLKGDI
MVKCYHKKYRSATRDVIFRLQFHTGAVQGYGLVFGKEDLDNASQDDRFPDNGKIELLFSA
TPEKIQGCEHLCNDHGVIVDFNTADPLIRWDSYESLGIGGEVSHTQGPVDGSLYAKVRKK
SASDPGVPSGPGPTASSPDHGDHTLSVSSDSGHSSASVRTDRTEEQPAAGPRRGLSPQEK
AELDQLLSGFGLDDPGSPLQDMTDAPGKYSGTRHVVPAQVHVNGDALLKDRETDILDDEM
PGHDLHSVDSIGTLSSSEGHQSAHLGPFAGHQSSQHSLLSDGFGSSPGDDAHGSLAPDLS
LGVDPVYEREQAFATREAKQPQPVLRRPSVSAQTQAYMQSGYSTQTWVRQQQMVAAHQYG
FTPDGEARLVGRSPEDRSSLGQAQSRVPVTPTRGSGSRVALQRGVGPTPHLPDAQRPPPG
KVLKPRFPDRVVNGTGPEPSADLAPGSPTLDIDQSIEQLNRLILELDPTFEPIPTHMNMP
GGQANGPVPPDSVGGGLRAGSLQDVGEAPSRGSVRPGSSGDEPLGGRFRKLSLGQYDNSA
GGQPAFPKCGWGKAPGAEQAASLAPFLSAADTKETVAPAYPPDPDGISGRTFFPAKSGSD
SSVSPTPAFPVSPETPYVTTPPHYLPFTPPGLQLGSASGLYRGAHEPRGCPEVLHRAVGM
SGSPVGPKSTALRADSPAAPAFQRAFTASCTITSSSPAQRRDSPSSGELLWVDGSPKATL
AVLGGGRQAGDLLSPSPDGPGRPHLPPTELQASFHNHQPSLVEPPEALGPPGGQAFLSFG
PGPMGGGLPPGEDPGALLANSHGAPQAPSTQGTAAAADNDGFLPHGFLTGTPGHGGHHSP
VLPGQSLALPGQPPLPEKKRASEGDRSAGSASPSSSGFSSPHSGSTMSIPFPNVLPDFPK
ALEAAAPSPDNPGDKHVSVNFVQDTSKFWYKADISREQAIAMLKDKEPGSFIVRDSHSFR
GAYGLAMKVATPPPSVLQLNKKAGDLANELVRHFLIECTPKGVRLKGCPNEPYFGSLTAL
VCQHSITPLALPCKLLIPDRDPLEEVADTSPQTAANSAAELLKQGAACNVWYLNSVEMES
LTGHQAVQKALSLTLVQEPPPMCTVVHFKVSAQGITLTDNQRKLFFRRHYPVSSVIFCAL
DPQDRKWITDGPCSRVFGFVARKQGSATDNVCHLFAEHDPEQPASAIVNFVSKVMIGSPK
KV
Download sequence
Identical sequences F1PQ78
ENSCAFP00000018118 XP_013975332.1.84170 ENSCAFP00000018118

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]