SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013975552.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013975552.1.84170
Domain Number 1 Region: 45-234
Classification Level Classification E-value
Superfamily Regulator of G-protein signaling, RGS 7.06e-66
Family Regulator of G-protein signaling, RGS 0.000000019
Further Details:      
 
Domain Number 2 Region: 457-684
Classification Level Classification E-value
Superfamily DBL homology domain (DH-domain) 4.19e-61
Family DBL homology domain (DH-domain) 0.000000609
Further Details:      
 
Domain Number 3 Region: 687-820
Classification Level Classification E-value
Superfamily PH domain-like 2e-37
Family Pleckstrin-homology domain (PH domain) 0.0000258
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) XP_013975552.1.84170
Sequence length 976
Comment PREDICTED: rho guanine nucleotide exchange factor 1 isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MEADNVARGLAPGPPRPGLVPVSIIGAEDEDFENELETNTEEQNSQFQSLEQVKRRPAHL
MALLQHVALQFEPGPLLCCLHADMLSSLGPKEAKKAFLDFCHCFLDKTAVLRVLVPPAVA
FELDRTRPEVISEDLQRQFVQEVVQSQQAAVSRLLEDFRSKRLMGMTPWEQDLTQLEAWV
GRDRASFEARERHLAERLLAHLEEMQHTISNDEEKSAAVVNAISLYMRHLGVRTKSGDKK
SGMNFFRKKVMGNRRSDEPTKTKKGLSIFLDPARWNRGEPQASDFRHLKVETDAEKPGLT
ERKGGLGVPSRDRNVGAPGQDVPGVSLHPLPGDSPDREPGVDTPPELGDPPPQGPASLEP
PGPSESTEEGPDTERRWKRLSGRLGRSESLRVSDRRRPSRGSLGAKGRGGGRSRSDVDMD
PSSATAVLGPARRATPEPGDEGDPGRSGLELEPEEPPGWRELIPPGTLHSLPKSQVKRQE
VISELLVTEAAHVRMLRVLHDLFYQPMLEGNFFSTEDLQNIFPSLDELIEVHSLFLDRLM
KRRQDSGCLIEEIGDVLLARFDGAEGKWFQKISSRFCSRQSFALEQLKAKQRKDPRFCAF
VQEAESRPRCRRLQLKDMIPTEMQRLTKYPLLLQSIGQNTEESAEREKVELAAECCREIL
HHVNQAVRDMEDLLRLKDYQKRLDLSLLRQSSDPMLSEFKNLDITKKKLIYEGPLTWRLT
KDKAVEVHVLLLDDLLLLLQRQDDRLLLKSHSRTLTPTPDGKTMLRPVLRLTSAITREVA
TDHKAFYVLFTWDQEAQIYELVAQTVSERKNWCSLITETAGSLKVPAPASRPKPRPSPSS
TREPLLSSSENGNGGGREMPPADGQTERILSTLLPYCRPRPEGQLAAKALEKVLSLKQLL
FPSEEDSGAGPPQEGDGVPGGGPLNPTQTHTQEIREKLLSLEETMKQLEEVEEEFCHLRL
LLSQLGENSTPQPGCT
Download sequence
Identical sequences J9P8E3
ENSCAFP00000042012 ENSCAFP00000041370 XP_013975552.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]