SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013976838.1.84170 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013976838.1.84170
Domain Number 1 Region: 131-229
Classification Level Classification E-value
Superfamily Cyclin-like 0.0000000000442
Family Cyclin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) XP_013976838.1.84170
Sequence length 305
Comment PREDICTED: cyclin-Y isoform X1 [Canis lupus familiaris]; AA=GCF_000002285.3; RF=representative genome; TAX=9615; STAX=9612; NAME=Canis lupus familiaris; breed=boxer; AL=Chromosome; RT=Major
Sequence
MPEWTVTRLGLVYKADLNMEFNPSDHPRASTIFLSKSQTDVREKRKSLFINHHPPGQIAR
KYSSCSTIFLDDSTVSQPNLKYTIKCVALAIYYHIKNRDPDGRMLLDIFDENLHPLSKSE
VPPDYDKHNPEQKQIYRFVRTLFSAAQLTAECAIVTLVYLERLLTYAEIDICPANWKRIV
LGAILLASKVWDDQAVWNVDYCQILKDITVEDMNELERQFLELLQFNINVPSSVYAKYYF
DLRSLAEANNLSFPLEPLSRERAHKLEAISRLCEDKYKDLRRPMRKRSASADNLTLPRWS
PAIIS
Download sequence
Identical sequences F1PHF7
ENSCAFP00000005478 ENSCAFP00000005478 XP_005616991.1.84170 XP_013976838.1.84170

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]