SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for XP_013982757.1.97760 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  XP_013982757.1.97760
Domain Number 1 Region: 491-642
Classification Level Classification E-value
Superfamily A middle domain of Talin 1 4.97e-62
Family A middle domain of Talin 1 0.000000769
Further Details:      
 
Domain Number 2 Region: 1516-1706
Classification Level Classification E-value
Superfamily I/LWEQ domain 7.22e-51
Family I/LWEQ domain 0.00012
Further Details:      
 
Domain Number 3 Region: 1060-1194
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 1.41e-45
Family VBS domain 0.00000937
Further Details:      
 
Domain Number 4 Region: 197-311
Classification Level Classification E-value
Superfamily Second domain of FERM 1.57e-31
Family Second domain of FERM 0.00000125
Further Details:      
 
Domain Number 5 Region: 312-402
Classification Level Classification E-value
Superfamily PH domain-like 2.46e-23
Family Third domain of FERM 0.0000182
Further Details:      
 
Domain Number 6 Region: 689-776
Classification Level Classification E-value
Superfamily I/LWEQ domain 0.0000000000000602
Family I/LWEQ domain 0.0092
Further Details:      
 
Domain Number 7 Region: 916-1036
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000000753
Family VBS domain 0.045
Further Details:      
 
Domain Number 8 Region: 1226-1353
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.00000148
Family VBS domain 0.026
Further Details:      
 
Domain Number 9 Region: 82-137
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.00000588
Family Ubiquitin-related 0.056
Further Details:      
 
Domain Number 10 Region: 808-881
Classification Level Classification E-value
Superfamily alpha-catenin/vinculin-like 0.0000298
Family VBS domain 0.046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) XP_013982757.1.97760
Sequence length 1733
Comment PREDICTED: talin-2-like [Salmo salar]; AA=GCF_000233375.1; RF=representative genome; TAX=8030; STAX=8030; NAME=Salmo salar; breed=double haploid; AL=Chromosome; RT=Major
Sequence
MVALSLKICVRQCNLVKTMQFEPSTAVYDTCRIIRERVPEAQTGQASDYGLFLSDEDPRK
GIWLESGRTLDYYMLRNGDILDYKKKQRPLKIKMLDGAVKTIMVDDSKTVGELLVTICSR
IGITNYEEYSLIQEVMEEKKEDGTGTLKKDRTLLRDERKMEKLKAKLHTDDDLNWLDHSR
TFREQGVEETETLLLRRKFFYSDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEF
AGIQAQIQFGPHIEHKHKPGFLDLKEFLPKEYIKQRGNEKKIFQDHKNCGEMTEIEAKVK
YVKLARSLRTYGVSFFLVKEKMKSKNKLVPRLLGITKESVMRVEEKTKDVVQEWPLTTVK
RWAASPKSFTLDFGEYQESYYSVQTTEGEQISQLIAGYIDIILKKKQSKDRFGLEGDEES
TMLEESVSPKKSTILQQQFNRVGRVEHGSVALPGVIRSGSIGTESLSMGTMPSAQQQVIM
GQMHRGHMPPLSSAQQALMGTINTSMQAVQQAQADLGEVDNLPPLGQDMASKVWIQNKVD
ESKHEIHSQVDAITAGTASVVNLTAGDPTDTDYTAVGCAITTISSNLTEMSKGVKLLAAL
IEDDTGGSNDLMGAARNLAGAVSDLLKAVEPASGEVRQGWWRQITCLNSGPGEPRVFTGF
CIFIASYLVGVSDPNSQAGHQGLVDAIQFARANQAIQMACQNLVDPDSSPSQVLSSATIV
AKHTSALCNACRLASSKTANPTAKRHFVQSAKEVANSTANLVKTIKALDGDFSQENRNTC
LVATAPLIEAVENLTAFASNPEFASVPAQISNEGSAAQEPILQSARAMLDSSTHLLKTAR
SLVINPKDPPTWSVLAGHSRTVSDSIKGLITAIRDKAPGQRECDYSIDNINRCIRNIEQA
SLAAVSQNLASRDDISLEALQEQLTSTVQEIGYLIDPISTAARGEAAQLGHKVTQLAGYY
EPLIRASVGVASKLQVHQQQMAFLDQTKTLAESALQMIYAAKEGGGNPKASHTHDAIAEA
AQLMREAVDDIMVTLNEAASEGGMVGAMVDSIAEAMGRLDEGTSPEPEGSFVDYQTTMVK
YSKAIAVTAQEMMTKSVTCPEELGGLASRVTTDYSQLALQGRLAAHTAEPQEIGFQIKAG
VQELGHGCIFLVQKAGALQITPSDSYTKRELIECARTVTEKVSMVLSALQAGNKGTQACI
TAASAVSGIIADLDTTIMFASAGTLNAENDESFADHRENILKTAKALVEDTKMLVSGAAS
SQDRLAQAAQSSAKTITQLTDVVKLGAASIGSDDPETQVVLINAVKDVAKALAELIGATK
CAAGKAADDPSMYQLKSAAKVMVTNVTSLLKTVKAVEDEATRGTRALEATIECIKQELTV
FQSKDVPEKSTTPEEFIRMTKGITTATAKAVAAGNSARQEDVISTANLSRKAIFDMLTTC
KQAAYHQEVNKDVRSRALLYGTECTTGYIDLLEHVLLVLQGPTAEQKQQLVFYSKRVAGA
VTELIQTAEAMKGTEWVDPEDPTVIAETELLGAAASIEAAAKKLEQLKPRAKPKQADETL
DFEEQILEAAKSIAAATSALVKSASAAQRELVAQGKVGSIPANAVDDGQWSQGLISAARM
VAAATSNLCEAANASVQGQASEEKLISSAKQVAASTAQLLVACKVKADQDSEAMRRLQAA
GNAVKRASDNLVRAAQKAAFHKADDDNVVVKTKFVGGIAQVRLQGSGRLHSDM
Download sequence
Identical sequences A0A1S3KVT5
XP_013982757.1.97760

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]